YNIC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YNIC - 2-deoxyglucose-6-phosphate phosphatase

UniProt:	P77247	Sequences: MSTPRQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLADVKLSSLTELTAKDLLG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13988
Length:	222 (205)
Sequences:	29434 (23287)
Seq/√Len:	1626.4

ECOLI - YNIC GPH YIEH YRFG YFBT PGMB YIGB YQAB YJJG YIHX
BACSU - YHCW PPAX PGMB YFNB YSAA
HALSA - Q9HQE2 Q9HSS2 Q9HP74 Q9HMC4
SULSO - Q7LXL6 Q97ZU6 Q7LX46 Q97WT6 Q97X58 Q97YZ1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_L	167_T	4.120	1.00
127_T	132_R	2.937	1.00
156_D	160_K	2.813	1.00
146_Y	150_H	2.794	1.00
181_S	188_S	2.601	1.00
172_E	177_G	2.591	1.00
119_L	123_E	2.516	1.00
9_A	163_V	2.442	1.00
102_A	134_S	2.420	1.00
98_R	102_A	2.374	1.00
7_I	187_R	2.309	1.00
112_G	137_A	2.275	1.00
156_D	159_A	2.260	1.00
110_L	136_D	2.249	1.00
119_L	143_K	2.228	1.00
12_F	111_V	2.162	1.00
35_S	78_R	2.123	1.00
115_S	122_L	2.121	1.00
114_A	153_V	2.111	1.00
158_A	168_C	2.106	1.00
146_Y	152_Q	2.071	1.00
182_K	206_D	2.026	1.00
137_A	160_K	2.010	1.00
178_M	188_S	1.986	1.00
210_S	214_E	1.976	1.00
179_I	183_A	1.885	1.00
31_D	82_R	1.871	1.00
187_R	206_D	1.855	1.00
164_D	167_T	1.813	1.00
10_A	109_L	1.760	1.00
105_K	134_S	1.727	1.00
158_A	186_M	1.707	1.00
105_K	136_D	1.703	1.00
170_A	181_S	1.668	1.00
169_V	189_I	1.665	1.00
11_I	170_A	1.661	1.00
103_L	107_Q	1.615	1.00
123_E	132_R	1.564	1.00
111_V	135_F	1.564	1.00
97_V	212_L	1.557	1.00
11_I	157_C	1.550	1.00
158_A	165_P	1.536	1.00
7_I	169_V	1.529	1.00
9_A	161_L	1.525	1.00
163_V	168_C	1.520	1.00
11_I	114_A	1.493	1.00
36_L	78_R	1.446	1.00
10_A	104_C	1.434	1.00
192_P	210_S	1.425	1.00
189_I	209_L	1.416	1.00
112_G	161_L	1.416	1.00
94_L	193_A	1.412	1.00
10_A	171_L	1.395	1.00
82_R	85_S	1.322	1.00
175_V	179_I	1.311	1.00
56_M	59_D	1.311	1.00
17_L	171_L	1.306	1.00
35_S	82_R	1.299	1.00
31_D	35_S	1.288	1.00
78_R	81_A	1.287	1.00
14_M	113_L	1.280	1.00
14_M	19_I	1.267	1.00
103_L	106_E	1.267	1.00
100_A	212_L	1.264	1.00
151_P	155_L	1.261	1.00
71_S	74_E	1.261	1.00
14_M	122_L	1.257	1.00
18_L	97_V	1.251	1.00
123_E	127_T	1.235	1.00
192_P	208_K	1.224	1.00
154_Y	170_A	1.216	1.00
96_G	99_E	1.213	1.00
27_R	86_L	1.212	1.00
74_E	78_R	1.206	1.00
139_A	160_K	1.199	1.00
31_D	86_L	1.192	1.00
122_L	140_S	1.182	1.00
211_S	214_E	1.166	1.00
11_I	168_C	1.158	1.00
93_L	131_L	1.156	1.00
189_I	207_V	1.127	1.00
139_A	157_C	1.122	1.00
154_Y	180_A	1.120	1.00
9_A	110_L	1.116	1.00
15_D	21_S	1.114	1.00
99_E	213_T	1.106	1.00
82_R	86_L	1.102	1.00
9_A	168_C	1.092	1.00
78_R	82_R	1.091	1.00
32_V	36_L	1.085	1.00
154_Y	186_M	1.082	1.00
168_C	186_M	1.081	1.00
105_K	111_V	1.070	1.00
152_Q	156_D	1.067	1.00
155_L	159_A	1.064	1.00
14_M	117_S	1.047	1.00
27_R	31_D	1.043	1.00
113_L	135_F	1.036	1.00
34_A	40_I	1.034	1.00
102_A	106_E	1.031	1.00
101_V	135_F	1.027	1.00
114_A	157_C	1.026	1.00
88_E	124_K	1.011	1.00
77_E	81_A	1.011	1.00
31_D	34_A	1.007	1.00
182_K	188_S	1.000	1.00
155_L	184_A	0.992	1.00
9_A	112_G	0.988	1.00
81_A	85_S	0.983	1.00
119_L	140_S	0.982	1.00
15_D	117_S	0.981	1.00
170_A	186_M	0.978	1.00
137_A	161_L	0.973	1.00
130_D	133_D	0.972	1.00
157_C	161_L	0.965	1.00
152_Q	155_L	0.959	1.00
124_K	128_M	0.953	1.00
180_A	184_A	0.947	1.00
124_K	127_T	0.941	1.00
30_L	34_A	0.937	1.00
59_D	63_A	0.931	1.00
99_E	102_A	0.930	1.00
59_D	72_R	0.917	1.00
122_L	125_V	0.916	1.00
27_R	30_L	0.913	1.00
98_R	134_S	0.912	1.00
15_D	115_S	0.909	1.00
178_M	205_A	0.906	1.00
119_L	142_E	0.902	1.00
144_L	156_D	0.899	1.00
176_N	179_I	0.897	1.00
115_S	140_S	0.896	1.00
56_M	60_L	0.894	1.00
11_I	186_M	0.893	1.00
154_Y	172_E	0.892	1.00
198_N	201_R	0.887	1.00
93_L	98_R	0.886	1.00
11_I	161_L	0.879	1.00
187_R	207_V	0.874	1.00
155_L	165_P	0.862	1.00
7_I	109_L	0.858	1.00
117_S	122_L	0.854	1.00
139_A	156_D	0.854	1.00
171_L	189_I	0.848	1.00
145_P	152_Q	0.846	1.00
104_C	109_L	0.846	1.00
73_Q	77_E	0.843	1.00
102_A	133_D	0.840	1.00
27_R	90_T	0.837	1.00
111_V	134_S	0.836	1.00
200_P	204_L	0.835	1.00
165_P	186_M	0.832	1.00
94_L	191_V	0.827	1.00
52_L	60_L	0.826	1.00
169_V	187_R	0.822	1.00
86_L	89_E	0.812	1.00
94_L	97_V	0.811	1.00
112_G	157_C	0.806	1.00
14_M	125_V	0.805	1.00
96_G	211_S	0.805	1.00
41_S	45_E	0.804	1.00
10_A	169_V	0.802	1.00
58_V	62_Y	0.796	1.00
8_L	109_L	0.789	1.00
60_L	63_A	0.785	1.00
101_V	134_S	0.785	1.00
182_K	204_L	0.784	1.00
76_V	80_I	0.780	1.00
55_D	59_D	0.776	1.00
26_D	30_L	0.772	1.00
140_S	143_K	0.771	1.00
42_R	45_E	0.767	1.00
33_M	38_V	0.765	1.00
19_I	125_V	0.764	1.00
19_I	129_F	0.762	1.00
104_C	111_V	0.752	1.00
154_Y	177_G	0.747	1.00
163_V	167_T	0.745	1.00
15_D	173_D	0.744	1.00
17_L	177_G	0.743	1.00
188_S	206_D	0.743	1.00
79_V	83_A	0.739	1.00
98_R	133_D	0.729	1.00
200_P	203_V	0.722	1.00
143_K	160_K	0.720	1.00
30_L	41_S	0.716	1.00
50_L	53_R	0.714	1.00
98_R	130_D	0.708	1.00
8_L	110_L	0.707	1.00
52_L	56_M	0.707	1.00
153_V	157_C	0.706	1.00
7_I	167_T	0.706	1.00
151_P	183_A	0.706	1.00
63_A	66_P	0.702	1.00
23_P	92_P	0.702	1.00
179_I	182_K	0.699	1.00
170_A	177_G	0.699	1.00
28_A	32_V	0.693	1.00
178_M	190_V	0.692	1.00
11_I	112_G	0.682	1.00
116_A	149_P	0.680	1.00
96_G	213_T	0.675	1.00
77_E	80_I	0.667	1.00
20_D	92_P	0.666	1.00
99_E	103_L	0.664	1.00
70_P	74_E	0.664	1.00
126_L	132_R	0.663	1.00
198_N	210_S	0.661	1.00
49_T	53_R	0.660	1.00
15_D	125_V	0.659	1.00
190_V	208_K	0.659	1.00
111_V	136_D	0.658	1.00
55_D	73_Q	0.658	1.00
86_L	90_T	0.657	1.00
93_L	129_F	0.656	1.00
28_A	82_R	0.656	1.00
116_A	147_S	0.655	1.00
116_A	176_N	0.654	1.00
30_L	40_I	0.652	1.00
193_A	212_L	0.650	1.00
24_L	91_R	0.649	1.00
25_W	117_S	0.648	1.00
16_G	22_E	0.647	1.00
60_L	64_R	0.645	1.00
62_Y	65_Q	0.645	1.00
122_L	138_L	0.644	1.00
165_P	168_C	0.643	1.00
96_G	100_A	0.643	1.00
25_W	29_E	0.641	1.00
110_L	163_V	0.640	1.00
8_L	163_V	0.638	1.00
53_R	56_M	0.638	1.00
137_A	157_C	0.637	1.00
153_V	180_A	0.636	1.00
123_E	138_L	0.632	1.00
88_E	128_M	0.631	1.00
75_V	78_R	0.628	1.00
209_L	212_L	0.627	1.00
144_L	153_V	0.627	1.00
45_E	48_D	0.625	1.00
135_F	138_L	0.624	1.00
139_A	153_V	0.623	1.00
141_A	153_V	0.623	1.00
100_A	171_L	0.622	1.00
21_S	117_S	0.622	1.00
20_D	23_P	0.617	1.00
74_E	77_E	0.616	1.00
83_A	87_V	0.616	1.00
36_L	74_E	0.613	1.00
49_T	52_L	0.609	1.00
158_A	163_V	0.609	1.00
25_W	79_V	0.607	1.00
40_I	43_R	0.607	1.00
114_A	170_A	0.605	1.00
30_L	42_R	0.601	1.00
75_V	79_V	0.600	1.00
43_R	47_P	0.600	1.00
34_A	39_D	0.600	1.00
19_I	91_R	0.598	1.00
105_K	108_G	0.598	1.00
190_V	200_P	0.596	1.00
158_A	184_A	0.593	1.00
12_F	100_A	0.593	1.00
47_P	50_L	0.589	1.00
122_L	126_L	0.587	1.00
23_P	27_R	0.586	1.00
20_D	94_L	0.585	1.00
170_A	180_A	0.585	1.00
17_L	191_V	0.583	1.00
102_A	105_K	0.581	1.00
85_S	89_E	0.579	1.00
114_A	139_A	0.577	1.00
80_I	84_I	0.575	1.00
126_L	131_L	0.574	1.00
48_D	60_L	0.573	1.00
97_V	100_A	0.569	1.00
97_V	101_V	0.568	1.00
155_L	158_A	0.565	1.00
105_K	133_D	0.564	1.00
93_L	97_V	0.561	1.00
95_P	213_T	0.556	1.00
100_A	104_C	0.556	1.00
69_G	73_Q	0.553	1.00
84_I	124_K	0.551	1.00
120_H	124_K	0.551	1.00
57_V	62_Y	0.550	1.00
100_A	103_L	0.545	1.00
50_L	54_I	0.545	1.00
176_N	180_A	0.541	1.00
107_Q	110_L	0.539	1.00
62_Y	67_W	0.538	1.00
11_I	154_Y	0.536	1.00
46_L	49_T	0.534	1.00
84_I	120_H	0.533	1.00
96_G	193_A	0.531	1.00
55_D	76_V	0.526	1.00
175_V	190_V	0.524	1.00
154_Y	181_S	0.522	1.00
36_L	75_V	0.518	1.00
7_I	10_A	0.517	1.00
117_S	121_M	0.513	1.00
10_A	111_V	0.506	1.00
81_A	84_I	0.503	1.00
180_A	183_A	0.502	1.00
49_T	54_I	0.502	1.00
158_A	164_D	0.502	1.00
116_A	141_A	0.502	1.00
57_V	60_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1te2A	2	0.982	100	0.257	Contact Map
4uw9A	1	0.9144	100	0.261	Contact Map
3nasA	2	0.8964	100	0.283	Contact Map
3l5kA	1	0.9775	100	0.293	Contact Map
4eekA	2	0.964	100	0.295	Contact Map
1swvA	2	0.964	100	0.297	Contact Map
3iruA	4	0.9865	100	0.298	Contact Map
3sd7A	1	0.9595	100	0.3	Contact Map
3s6jA	2	0.9595	100	0.304	Contact Map
2hszA	1	0.982	100	0.31	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0084 seconds.