CUSF - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CUSF - Cation efflux system protein CusF

UniProt:	P77214	Sequences: MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14234
Length:	110 (99)
Sequences:	582 (463)
Seq/√Len:	46.5

ECOLI - CUSF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_G	92_F	3.876	1.00
25_H	28_E	2.961	1.00
42_G	56_I	2.702	1.00
45_K	55_T	2.657	1.00
75_I	81_M	2.591	1.00
47_I	86_T	2.565	1.00
41_T	59_D	2.560	1.00
43_V	57_H	2.493	1.00
40_A	61_I	2.414	1.00
91_A	107_K	2.260	1.00
56_I	92_F	2.127	1.00
49_L	82_S	2.087	1.00
12_L	15_V	1.870	0.99
41_T	91_A	1.851	0.99
45_K	57_H	1.809	0.99
63_A	66_W	1.804	0.99
44_V	54_I	1.752	0.98
44_V	56_I	1.662	0.98
85_K	88_D	1.647	0.98
18_F	21_Q	1.459	0.95
61_I	94_F	1.384	0.93
13_F	16_I	1.336	0.92
27_H	30_M	1.333	0.92
48_D	51_S	1.322	0.92
60_P	68_E	1.292	0.91
25_H	30_M	1.278	0.90
10_F	15_V	1.244	0.89
64_V	94_F	1.216	0.88
39_S	66_W	1.209	0.88
61_I	93_N	1.195	0.87
48_D	53_K	1.171	0.86
47_I	65_N	1.168	0.86
16_I	19_N	1.158	0.85
40_A	94_F	1.154	0.85
9_M	13_F	1.152	0.85
94_F	101_S	1.147	0.85
84_I	106_I	1.130	0.84
46_G	55_T	1.111	0.83
40_A	66_W	1.107	0.83
25_H	29_T	1.103	0.82
46_G	66_W	1.088	0.81
46_G	86_T	1.085	0.81
38_I	63_A	1.072	0.81
9_M	16_I	1.071	0.80
78_Q	100_L	1.048	0.79
63_A	95_V	1.021	0.77
40_A	92_F	1.017	0.77
24_E	27_H	1.013	0.77
17_G	20_A	1.007	0.76
95_V	104_Q	1.003	0.76
14_T	26_H	0.994	0.75
39_S	93_N	0.987	0.75
56_I	90_V	0.971	0.73
9_M	15_V	0.956	0.72
61_I	97_Q	0.951	0.72
44_V	84_I	0.944	0.71
66_W	93_N	0.928	0.70
90_V	93_N	0.925	0.70
87_G	104_Q	0.917	0.69
17_G	23_N	0.913	0.69
49_L	90_V	0.892	0.67
40_A	63_A	0.866	0.65
54_I	84_I	0.865	0.65
23_N	27_H	0.861	0.64
19_N	22_A	0.858	0.64
53_K	74_T	0.855	0.64
58_H	69_M	0.850	0.63
19_N	29_T	0.849	0.63
53_K	72_R	0.833	0.62
66_W	94_F	0.832	0.62
96_Q	101_S	0.828	0.61
96_Q	99_N	0.827	0.61
14_T	82_S	0.819	0.60
16_I	23_N	0.808	0.59
24_E	49_L	0.803	0.59
67_P	76_T	0.802	0.59
62_A	65_N	0.785	0.57
57_H	68_E	0.774	0.56
82_S	105_D	0.774	0.56
87_G	99_N	0.770	0.56
54_I	83_E	0.755	0.54
18_F	23_N	0.755	0.54
61_I	72_R	0.753	0.54
33_A	103_L	0.752	0.54
55_T	68_E	0.749	0.54
63_A	76_T	0.747	0.53
66_W	101_S	0.745	0.53
73_F	84_I	0.743	0.53
75_I	92_F	0.740	0.53
49_L	89_K	0.735	0.52
9_M	23_N	0.720	0.51
64_V	68_E	0.712	0.50
15_V	18_F	0.712	0.50
72_R	94_F	0.711	0.50
93_N	107_K	0.710	0.50
44_V	74_T	0.704	0.49
97_Q	102_L	0.684	0.47
33_A	52_K	0.684	0.47
50_E	106_I	0.669	0.46
12_L	18_F	0.665	0.45
44_V	90_V	0.651	0.44
66_W	72_R	0.644	0.43
17_G	22_A	0.644	0.43
52_K	81_M	0.638	0.43
39_S	63_A	0.637	0.43
10_F	18_F	0.636	0.42
57_H	70_T	0.625	0.41
80_K	106_I	0.625	0.41
14_T	18_F	0.625	0.41
60_P	64_V	0.620	0.41
24_E	30_M	0.618	0.41
39_S	60_P	0.616	0.40
37_V	50_E	0.615	0.40
12_L	19_N	0.612	0.40
77_P	95_V	0.610	0.40
38_I	94_F	0.608	0.40
12_L	20_A	0.605	0.39
11_S	16_I	0.605	0.39
100_L	104_Q	0.602	0.39
56_I	88_D	0.594	0.38
50_E	82_S	0.592	0.38
46_G	72_R	0.591	0.38
93_N	105_D	0.580	0.37
38_I	62_A	0.578	0.37
21_Q	30_M	0.578	0.37
61_I	106_I	0.578	0.37
82_S	89_K	0.574	0.37
14_T	20_A	0.572	0.36
11_S	59_D	0.561	0.35
38_I	66_W	0.559	0.35
13_F	21_Q	0.559	0.35
66_W	95_V	0.553	0.35
9_M	96_Q	0.551	0.34
23_N	26_H	0.542	0.34
95_V	107_K	0.542	0.34
61_I	101_S	0.540	0.33
59_D	99_N	0.538	0.33
46_G	68_E	0.537	0.33
55_T	72_R	0.536	0.33
83_E	103_L	0.536	0.33
57_H	72_R	0.534	0.33
19_N	26_H	0.526	0.32
94_F	103_L	0.514	0.31
70_T	81_M	0.514	0.31
24_E	28_E	0.512	0.31
24_E	29_T	0.508	0.31
67_P	73_F	0.502	0.30
40_A	43_V	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vb2X	1	0.6818	100	0.277	Contact Map
2qcpX	1	0.7273	99.9	0.298	Contact Map
2l55A	1	0.6727	99.9	0.352	Contact Map
2wtpA	2	0.5455	97.1	0.796	Contact Map
1c9oA	2	0.5636	64.8	0.89	Contact Map
2lxjA	1	0.5818	62	0.892	Contact Map
3a0jA	1	0.5727	59.6	0.894	Contact Map
3ts2A	1	0.6818	58.5	0.895	Contact Map
3i2zB	2	0.6091	54.8	0.897	Contact Map
3camA	2	0.5727	54.5	0.897	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.