YAGT - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YAGT - Putative xanthine dehydrogenase YagT iron-sulfur-binding subunit

UniProt:	P77165	Sequences: MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAATAVVYPHSTLAASVPAATPAPEIMPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGEIKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13559
Length:	229 (190)
Sequences:	611 (406)
Seq/√Len:	29.4

ECOLI - YAGT XDHD XDHC
BACSU - XDHE
SULSO - Q97VI6 Q97W14

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
112_N	129_A	4.508	1.00
152_K	222_D	4.135	1.00
66_K	130_E	3.418	1.00
167_C	202_R	3.331	1.00
148_A	152_K	3.070	1.00
196_A	221_E	3.052	1.00
199_I	217_L	2.935	1.00
126_H	129_A	2.906	1.00
61_M	78_T	2.895	1.00
144_H	170_V	2.767	1.00
76_V	89_N	2.758	1.00
110_L	171_A	2.708	1.00
80_T	85_T	2.474	0.99
110_L	167_C	2.461	0.99
134_I	166_I	2.272	0.99
199_I	220_I	2.268	0.99
77_D	80_T	2.256	0.99
24_T	55_T	2.239	0.99
80_T	89_N	2.215	0.98
115_R	175_E	2.183	0.98
153_H	222_D	2.089	0.98
65_L	72_E	1.914	0.96
63_L	76_V	1.848	0.95
38_T	42_Y	1.819	0.95
167_C	194_T	1.804	0.94
196_A	217_L	1.786	0.94
137_L	170_V	1.729	0.93
146_M	223_A	1.714	0.93
173_L	202_R	1.708	0.93
194_T	202_R	1.704	0.92
173_L	192_P	1.641	0.91
95_T	168_S	1.640	0.91
62_P	75_E	1.592	0.90
118_A	207_I	1.573	0.89
214_A	218_A	1.572	0.89
198_E	202_R	1.553	0.88
203_M	220_I	1.546	0.88
172_V	191_A	1.541	0.88
172_V	202_R	1.531	0.88
146_M	170_V	1.522	0.87
172_V	192_P	1.519	0.87
196_A	218_A	1.512	0.87
192_P	202_R	1.511	0.87
165_Q	212_A	1.501	0.87
100_D	215_N	1.494	0.86
66_K	71_T	1.462	0.85
112_N	121_T	1.455	0.85
59_E	78_T	1.444	0.84
86_L	109_V	1.379	0.81
77_D	101_H	1.373	0.81
103_Q	169_S	1.369	0.81
117_N	168_S	1.359	0.80
28_L	32_S	1.351	0.80
67_V	90_L	1.346	0.80
117_N	126_H	1.339	0.79
64_T	73_Q	1.315	0.78
76_V	85_T	1.262	0.75
103_Q	212_A	1.257	0.75
111_V	116_L	1.253	0.75
27_D	30_K	1.251	0.75
167_C	192_P	1.240	0.74
173_L	194_T	1.236	0.74
64_T	71_T	1.217	0.72
39_A	95_T	1.212	0.72
101_H	160_Y	1.211	0.72
85_T	131_I	1.194	0.71
58_P	78_T	1.190	0.71
80_T	224_A	1.180	0.70
85_T	89_N	1.171	0.70
211_G	214_A	1.154	0.68
165_Q	203_M	1.151	0.68
172_V	194_T	1.142	0.68
95_T	155_G	1.142	0.68
191_A	202_R	1.139	0.67
110_L	202_R	1.135	0.67
138_G	155_G	1.131	0.67
81_T	109_V	1.128	0.67
199_I	221_E	1.121	0.66
121_T	126_H	1.116	0.66
31_V	129_A	1.107	0.65
77_D	89_N	1.106	0.65
103_Q	146_M	1.100	0.65
117_N	124_V	1.100	0.65
79_R	115_R	1.099	0.65
146_M	169_S	1.085	0.63
195_T	198_E	1.079	0.63
36_A	39_A	1.074	0.63
94_G	135_E	1.071	0.62
30_K	35_T	1.054	0.61
117_N	129_A	1.050	0.61
79_R	175_E	1.046	0.61
45_S	48_A	1.042	0.60
146_M	173_L	1.039	0.60
167_C	191_A	1.033	0.60
50_S	142_N	1.029	0.59
172_V	220_I	1.026	0.59
60_I	75_E	1.015	0.58
101_H	212_A	1.012	0.58
116_L	126_H	1.009	0.58
173_L	191_A	1.007	0.58
23_L	62_P	0.987	0.56
155_G	225_G	0.978	0.55
191_A	194_T	0.974	0.55
46_T	49_A	0.970	0.55
101_H	146_M	0.952	0.53
211_G	218_A	0.951	0.53
146_M	166_I	0.950	0.53
126_H	131_I	0.948	0.53
193_E	224_A	0.948	0.53
84_D	97_K	0.948	0.53
30_K	152_K	0.936	0.52
114_R	191_A	0.936	0.52
167_C	172_V	0.900	0.49
29_I	32_S	0.888	0.48
81_T	101_H	0.885	0.48
200_R	203_M	0.879	0.48
103_Q	202_R	0.878	0.48
167_C	198_E	0.877	0.47
97_K	165_Q	0.874	0.47
74_L	85_T	0.872	0.47
138_G	141_D	0.857	0.46
214_A	221_E	0.854	0.46
126_H	215_N	0.827	0.44
85_T	196_A	0.822	0.43
144_H	166_I	0.821	0.43
150_F	162_T	0.816	0.43
68_N	135_E	0.814	0.43
84_D	201_E	0.805	0.42
70_K	130_E	0.804	0.42
139_S	142_N	0.802	0.42
202_R	224_A	0.801	0.42
27_D	34_A	0.800	0.41
169_S	203_M	0.799	0.41
140_P	146_M	0.799	0.41
24_T	59_E	0.797	0.41
56_P	146_M	0.786	0.40
36_A	42_Y	0.783	0.40
93_I	151_I	0.769	0.39
23_L	55_T	0.769	0.39
103_Q	160_Y	0.769	0.39
27_D	218_A	0.760	0.38
100_D	201_E	0.759	0.38
92_L	147_Q	0.756	0.38
203_M	216_I	0.748	0.38
218_A	222_D	0.747	0.38
95_T	156_F	0.741	0.37
28_L	221_E	0.741	0.37
30_K	222_D	0.740	0.37
203_M	212_A	0.740	0.37
97_K	201_E	0.736	0.37
59_E	131_I	0.736	0.37
101_H	117_N	0.735	0.37
122_L	198_E	0.732	0.36
31_V	224_A	0.729	0.36
83_L	105_G	0.729	0.36
92_L	95_T	0.726	0.36
71_T	197_D	0.725	0.36
70_K	73_Q	0.718	0.35
51_V	54_A	0.717	0.35
105_G	216_I	0.707	0.35
63_L	85_T	0.695	0.34
23_L	28_L	0.692	0.34
67_V	72_E	0.691	0.33
50_S	64_T	0.691	0.33
141_D	195_T	0.691	0.33
23_L	60_I	0.689	0.33
29_I	48_A	0.687	0.33
221_E	224_A	0.681	0.33
98_G	212_A	0.675	0.32
193_E	202_R	0.675	0.32
37_A	78_T	0.674	0.32
194_T	217_L	0.673	0.32
27_D	130_E	0.673	0.32
169_S	201_E	0.672	0.32
100_D	103_Q	0.671	0.32
116_L	125_M	0.668	0.32
66_K	73_Q	0.667	0.32
31_V	155_G	0.661	0.31
50_S	54_A	0.657	0.31
22_S	195_T	0.653	0.31
55_T	128_G	0.651	0.31
169_S	212_A	0.650	0.31
57_A	71_T	0.648	0.31
120_L	165_Q	0.647	0.30
37_A	53_A	0.644	0.30
121_T	215_N	0.641	0.30
88_E	166_I	0.640	0.30
35_T	40_V	0.635	0.30
154_D	212_A	0.629	0.29
77_D	131_I	0.626	0.29
42_Y	45_S	0.626	0.29
165_Q	201_E	0.624	0.29
146_M	171_A	0.622	0.29
48_A	70_K	0.622	0.29
165_Q	216_I	0.620	0.29
60_I	130_E	0.618	0.29
116_L	121_T	0.617	0.29
83_L	97_K	0.612	0.28
169_S	202_R	0.610	0.28
165_Q	169_S	0.609	0.28
97_K	203_M	0.609	0.28
193_E	199_I	0.608	0.28
42_Y	49_A	0.607	0.28
65_L	73_Q	0.607	0.28
79_R	166_I	0.601	0.27
34_A	38_T	0.599	0.27
111_V	126_H	0.599	0.27
56_P	71_T	0.596	0.27
116_L	131_I	0.595	0.27
132_T	144_H	0.593	0.27
52_P	59_E	0.593	0.27
57_A	131_I	0.587	0.27
56_P	75_E	0.586	0.27
200_R	215_N	0.584	0.26
134_I	143_L	0.580	0.26
24_T	128_G	0.580	0.26
22_S	41_V	0.580	0.26
118_A	174_K	0.580	0.26
105_G	206_N	0.579	0.26
55_T	71_T	0.579	0.26
28_L	138_G	0.579	0.26
37_A	93_I	0.578	0.26
56_P	70_K	0.576	0.26
121_T	129_A	0.576	0.26
46_T	51_V	0.575	0.26
192_P	224_A	0.575	0.26
22_S	70_K	0.573	0.26
38_T	222_D	0.570	0.26
28_L	222_D	0.568	0.25
111_V	129_A	0.567	0.25
103_Q	201_E	0.567	0.25
113_G	171_A	0.565	0.25
67_V	207_I	0.565	0.25
83_L	216_I	0.565	0.25
41_V	130_E	0.564	0.25
110_L	174_K	0.564	0.25
143_L	147_Q	0.564	0.25
41_V	127_Q	0.560	0.25
85_T	211_G	0.558	0.25
27_D	31_V	0.558	0.25
114_R	174_K	0.557	0.25
33_A	37_A	0.555	0.25
149_A	154_D	0.555	0.25
22_S	46_T	0.552	0.25
78_T	192_P	0.550	0.24
217_L	221_E	0.548	0.24
97_K	115_R	0.545	0.24
31_V	34_A	0.544	0.24
175_E	202_R	0.543	0.24
89_N	215_N	0.536	0.24
109_V	131_I	0.534	0.23
60_I	78_T	0.532	0.23
150_F	154_D	0.531	0.23
67_V	172_V	0.529	0.23
48_A	64_T	0.529	0.23
120_L	212_A	0.527	0.23
33_A	59_E	0.525	0.23
91_H	138_G	0.524	0.23
48_A	51_V	0.524	0.23
65_L	130_E	0.523	0.23
81_T	103_Q	0.523	0.23
45_S	52_P	0.522	0.23
105_G	120_L	0.521	0.23
61_M	112_N	0.520	0.23
45_S	50_S	0.519	0.23
125_M	131_I	0.517	0.23
95_T	117_N	0.513	0.22
48_A	112_N	0.511	0.22
98_G	165_Q	0.510	0.22
198_E	224_A	0.510	0.22
34_A	217_L	0.510	0.22
44_H	65_L	0.508	0.22
34_A	54_A	0.508	0.22
43_P	218_A	0.508	0.22
110_L	114_R	0.507	0.22
40_V	57_A	0.506	0.22
74_L	103_Q	0.506	0.22
155_G	220_I	0.505	0.22
207_I	211_G	0.503	0.22
110_L	198_E	0.502	0.22
36_A	171_A	0.502	0.22
50_S	53_A	0.502	0.22
40_V	49_A	0.502	0.22
42_Y	46_T	0.501	0.22
34_A	51_V	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3uncA	2	0.655	100	0.338	Contact Map
3zyvA	3	0.6594	100	0.342	Contact Map
2w3sA	1	0.6507	100	0.371	Contact Map
3nvwA	1	0.6638	100	0.375	Contact Map
1dgjA	1	0.6769	100	0.384	Contact Map
4usaA	2	0.6769	100	0.395	Contact Map
1n62A	1	0.6769	100	0.442	Contact Map
3hrdD	1	0.6856	100	0.447	Contact Map
1rm6C	1	0.6812	100	0.483	Contact Map
1t3qA	1	0.6856	100	0.486	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.