YEGL - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YEGL - Uncharacterized protein YegL

UniProt:	P76396	Sequences: MSEQITFATSDFASNPEPRCPCILLLDVSGSMNGRPINELNAGLVTFRDELLADPLALKRVELGIVTFGPVHVEQPFTSAANFFPPILFAQGDTPMGAAITKALDMVEERKREYRANGISYYRPWIFLITDGAPTDEWQAAANKVFRGEEDKRFAFFSIGVQGADMKTLAQISVRQPLPLQGLQFRELFSWLSSSLRSVSRSTPGTEVVLEAPKGWTSV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14055
Length:	219 (176)
Sequences:	7970 (5066)
Seq/√Len:	381.9

ECOLI - YEGL
BACSU - YCBR YWMD YWMC
SULSO - Q97Z45 Q97Z48

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_V	85_P	3.780	1.00
49_D	81_A	3.651	1.00
23_I	64_G	2.974	1.00
45_V	81_A	2.559	1.00
21_P	62_E	2.499	1.00
103_A	126_I	2.466	1.00
28_V	67_T	2.368	1.00
184_Q	187_E	2.259	1.00
25_L	103_A	2.239	1.00
26_L	44_L	2.199	1.00
21_P	124_P	2.161	1.00
94_T	131_D	2.110	1.00
24_L	44_L	2.062	1.00
138_W	142_A	2.039	1.00
166_M	181_Q	2.009	1.00
139_Q	171_Q	1.978	1.00
71_V	102_K	1.895	1.00
143_N	151_D	1.856	1.00
25_L	126_I	1.841	1.00
76_P	79_S	1.822	1.00
100_I	145_V	1.801	1.00
138_W	141_A	1.793	1.00
101_T	105_D	1.786	1.00
174_V	178_L	1.783	1.00
37_I	41_N	1.701	1.00
95_P	98_A	1.694	1.00
166_M	170_A	1.691	1.00
31_S	94_T	1.687	1.00
31_S	131_D	1.653	1.00
100_I	126_I	1.649	1.00
104_L	152_K	1.648	1.00
67_T	74_E	1.631	1.00
96_M	128_L	1.619	1.00
104_L	145_V	1.616	1.00
28_V	37_I	1.553	1.00
26_L	40_L	1.536	1.00
125_W	157_F	1.480	1.00
134_P	168_T	1.468	1.00
44_L	84_F	1.443	1.00
48_R	63_L	1.442	1.00
167_K	171_Q	1.431	1.00
108_E	152_K	1.428	1.00
142_A	146_F	1.421	1.00
38_N	41_N	1.409	1.00
158_S	173_S	1.401	1.00
73_V	102_K	1.391	1.00
35_R	38_N	1.379	1.00
158_S	169_L	1.376	1.00
101_T	141_A	1.365	1.00
167_K	170_A	1.344	1.00
126_I	156_F	1.335	1.00
141_A	144_K	1.335	1.00
160_G	169_L	1.322	1.00
133_A	165_D	1.320	1.00
48_R	80_A	1.318	1.00
141_A	145_V	1.278	1.00
46_T	189_F	1.268	1.00
104_L	144_K	1.267	1.00
155_A	178_L	1.263	1.00
24_L	47_F	1.258	1.00
96_M	134_P	1.257	1.00
23_I	66_V	1.241	1.00
23_I	103_A	1.236	1.00
102_K	106_M	1.222	1.00
47_F	51_L	1.218	1.00
139_Q	142_A	1.214	1.00
129_I	161_V	1.213	1.00
48_R	84_F	1.204	1.00
23_I	107_V	1.203	1.00
42_A	46_T	1.201	1.00
146_F	174_V	1.198	1.00
46_T	49_D	1.196	1.00
41_N	84_F	1.143	1.00
66_V	99_A	1.138	1.00
139_Q	143_N	1.131	1.00
78_T	82_N	1.126	1.00
64_G	107_V	1.123	1.00
123_R	155_A	1.120	1.00
94_T	132_G	1.115	1.00
77_F	81_A	1.093	1.00
80_A	83_F	1.085	1.00
93_D	135_T	1.083	1.00
102_K	105_D	1.081	1.00
140_A	143_N	1.057	1.00
49_D	77_F	1.051	1.00
143_N	146_F	1.046	1.00
142_A	145_V	1.041	1.00
100_I	172_I	1.029	1.00
66_V	71_V	1.029	1.00
22_C	125_W	1.025	1.00
50_E	193_S	1.020	1.00
95_P	135_T	1.011	1.00
68_F	96_M	0.993	1.00
104_L	141_A	0.984	1.00
79_S	82_N	0.977	1.00
187_E	190_S	0.977	1.00
97_G	141_A	0.971	1.00
28_V	90_A	0.968	1.00
100_I	156_F	0.966	1.00
144_K	151_D	0.962	1.00
33_N	36_P	0.961	1.00
66_V	103_A	0.960	1.00
30_G	92_G	0.959	1.00
39_E	42_A	0.957	1.00
82_N	86_P	0.952	1.00
97_G	136_D	0.945	1.00
164_A	181_Q	0.942	1.00
101_T	144_K	0.935	1.00
27_D	132_G	0.926	1.00
30_G	90_A	0.924	1.00
28_V	88_L	0.905	1.00
66_V	102_K	0.897	1.00
191_W	194_S	0.896	1.00
50_E	196_L	0.894	1.00
160_G	179_P	0.893	1.00
108_E	113_E	0.891	1.00
20_C	125_W	0.885	1.00
25_L	66_V	0.880	1.00
19_R	122_Y	0.869	1.00
45_V	86_P	0.863	1.00
161_V	185_F	0.863	1.00
170_A	174_V	0.850	1.00
109_E	113_E	0.847	1.00
36_P	39_E	0.845	1.00
71_V	99_A	0.844	1.00
70_P	93_D	0.840	1.00
126_I	154_F	0.828	1.00
24_L	127_F	0.825	1.00
128_L	158_S	0.824	1.00
166_M	179_P	0.823	1.00
64_G	106_M	0.821	1.00
77_F	80_A	0.817	1.00
173_S	179_P	0.816	1.00
39_E	186_R	0.813	1.00
100_I	128_L	0.812	1.00
137_E	140_A	0.807	1.00
51_L	61_V	0.806	1.00
109_E	112_R	0.798	1.00
158_S	179_P	0.797	1.00
46_T	50_E	0.795	1.00
20_C	61_V	0.792	1.00
157_F	198_S	0.785	1.00
24_L	63_L	0.783	1.00
157_F	178_L	0.782	1.00
34_G	38_N	0.781	1.00
170_A	176_Q	0.773	1.00
157_F	195_S	0.771	1.00
105_D	108_E	0.767	1.00
30_G	131_D	0.760	1.00
189_F	192_L	0.758	1.00
160_G	181_Q	0.757	1.00
38_N	42_A	0.753	1.00
175_R	178_L	0.752	1.00
67_T	72_H	0.752	1.00
30_G	91_Q	0.751	1.00
162_Q	165_D	0.749	1.00
104_L	154_F	0.748	1.00
126_I	145_V	0.740	1.00
33_N	89_F	0.740	1.00
36_P	89_F	0.739	1.00
58_L	61_V	0.737	1.00
128_L	172_I	0.735	1.00
145_V	154_F	0.734	1.00
67_T	90_A	0.733	1.00
125_W	199_V	0.732	1.00
79_S	83_F	0.731	1.00
70_P	95_P	0.728	1.00
170_A	179_P	0.728	1.00
107_V	126_I	0.727	1.00
138_W	146_F	0.723	1.00
27_D	31_S	0.723	1.00
67_T	88_L	0.719	1.00
140_A	144_K	0.717	1.00
42_A	45_V	0.709	1.00
165_D	168_T	0.709	1.00
69_G	95_P	0.709	1.00
48_R	81_A	0.708	1.00
32_M	36_P	0.707	1.00
128_L	156_F	0.704	1.00
48_R	77_F	0.704	1.00
45_V	49_D	0.701	1.00
37_I	40_L	0.699	0.99
24_L	40_L	0.694	0.99
41_N	45_V	0.689	0.99
55_P	60_R	0.686	0.99
28_V	72_H	0.685	0.99
98_A	102_K	0.681	0.99
22_C	63_L	0.680	0.99
134_P	138_W	0.678	0.99
71_V	98_A	0.678	0.99
156_F	172_I	0.676	0.99
56_L	63_L	0.671	0.99
137_E	141_A	0.669	0.99
99_A	103_A	0.668	0.99
101_T	104_L	0.666	0.99
70_P	92_G	0.661	0.99
65_I	87_I	0.656	0.99
82_N	85_P	0.654	0.99
98_A	101_T	0.654	0.99
43_G	47_F	0.651	0.99
69_G	90_A	0.648	0.99
71_V	95_P	0.643	0.99
132_G	169_L	0.641	0.99
97_G	134_P	0.634	0.99
29_S	94_T	0.632	0.99
66_V	107_V	0.627	0.99
32_M	94_T	0.627	0.99
141_A	146_F	0.625	0.99
78_T	81_A	0.624	0.99
80_A	84_F	0.620	0.99
72_H	90_A	0.611	0.99
74_E	83_F	0.605	0.99
103_A	107_V	0.598	0.98
188_L	192_L	0.597	0.98
45_V	48_R	0.596	0.98
73_V	107_V	0.593	0.98
28_V	69_G	0.590	0.98
31_S	132_G	0.588	0.98
94_T	130_T	0.587	0.98
20_C	123_R	0.581	0.98
93_D	131_D	0.581	0.98
96_M	130_T	0.578	0.98
159_I	188_L	0.575	0.98
16_P	200_S	0.570	0.98
96_M	168_T	0.567	0.98
190_S	194_S	0.567	0.98
192_L	195_S	0.563	0.98
68_F	99_A	0.558	0.98
110_R	113_E	0.553	0.97
143_N	175_R	0.551	0.97
22_C	47_F	0.543	0.97
39_E	185_F	0.543	0.97
81_A	85_P	0.542	0.97
62_E	75_Q	0.542	0.97
182_G	191_W	0.541	0.97
73_V	106_M	0.540	0.97
130_T	158_S	0.537	0.97
125_W	155_A	0.537	0.97
26_L	65_I	0.536	0.97
40_L	129_I	0.536	0.97
23_I	126_I	0.535	0.97
138_W	168_T	0.535	0.97
43_G	188_L	0.533	0.97
183_L	187_E	0.532	0.97
146_F	156_F	0.532	0.97
32_M	40_L	0.531	0.97
168_T	172_I	0.531	0.97
180_L	191_W	0.527	0.97
160_G	164_A	0.525	0.96
145_V	156_F	0.522	0.96
35_R	39_E	0.521	0.96
41_N	87_I	0.515	0.96
96_M	172_I	0.514	0.96
108_E	111_K	0.513	0.96
127_F	159_I	0.513	0.96
57_A	62_E	0.513	0.96
142_A	172_I	0.510	0.96
124_P	154_F	0.508	0.96
180_L	195_S	0.506	0.96
25_L	99_A	0.503	0.95
103_A	145_V	0.503	0.95
97_G	101_T	0.501	0.95
169_L	179_P	0.500	0.95
134_P	142_A	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4okrA	1	0.8402	100	0.372	Contact Map
4okuA	2	0.8584	100	0.374	Contact Map
4cn9A	1	0.8767	100	0.387	Contact Map
4nehA	1	0.9269	100	0.388	Contact Map
4igiA	1	0.8265	100	0.398	Contact Map
4f1jA	1	0.8174	99.9	0.408	Contact Map
3zqkA	1	0.7854	99.9	0.41	Contact Map
1ijbA	1	0.8539	99.9	0.41	Contact Map
3n2nF	5	0.79	99.9	0.413	Contact Map
4hqoA	1	0.9315	99.9	0.419	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.