YOEA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOEA - Putative uncharacterized protein YoeA

UniProt:	P76356	Sequences: MLYNIPCRIYILSTLSLCISGIVSTATATSSETKISNEETLVVTTNRSASNLWESPATIQVIDQQTLQNSTNASIADNLQDIPGVEITDNSLAGRKQIRIRGEASSRVLILIDGQEVTYQRAGDNYGVGLLIDESALERVEVVKGPYSVLYGSQAIGGIVNFITKKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14308
Length:	167 (143)
Sequences:	28498 (22196)
Seq/√Len:	1856.2

ECOLI - YOEA FHUE FHUA CIRA FEPA BTUB FIU YNCD FECA YDDB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_Q	68_Q	3.322	1.00
139_R	163_I	2.959	1.00
137_L	162_F	2.653	1.00
70_S	81_D	2.425	1.00
63_D	66_T	2.295	1.00
61_V	141_E	2.276	1.00
74_S	77_D	2.121	1.00
82_I	142_V	2.065	1.00
60_Q	144_K	2.013	1.00
112_I	117_V	1.993	1.00
112_I	164_T	1.980	1.00
51_N	54_E	1.972	1.00
133_D	136_A	1.928	1.00
66_T	69_N	1.764	1.00
111_L	116_E	1.751	1.00
65_Q	69_N	1.698	1.00
138_E	165_K	1.673	1.00
22_I	25_T	1.632	1.00
28_A	31_S	1.580	1.00
64_Q	165_K	1.558	1.00
38_E	41_L	1.558	1.00
64_Q	138_E	1.545	1.00
109_L	116_E	1.543	1.00
99_R	104_A	1.536	1.00
23_V	26_A	1.526	1.00
27_T	31_S	1.512	1.00
46_N	50_S	1.507	1.00
38_E	42_V	1.498	1.00
116_E	154_Q	1.464	1.00
36_S	39_E	1.450	1.00
141_E	161_N	1.439	1.00
65_Q	68_Q	1.438	1.00
77_D	80_Q	1.434	1.00
20_S	24_S	1.424	1.00
24_S	27_T	1.411	1.00
20_S	25_T	1.391	1.00
55_S	59_I	1.376	1.00
110_I	162_F	1.364	1.00
50_S	54_E	1.360	1.00
113_D	164_T	1.334	1.00
72_N	78_N	1.300	1.00
100_I	142_V	1.299	1.00
85_V	100_I	1.295	1.00
37_N	40_T	1.291	1.00
20_S	23_V	1.281	1.00
21_G	24_S	1.275	1.00
23_V	27_T	1.273	1.00
73_A	77_D	1.265	1.00
75_I	162_F	1.262	1.00
67_L	78_N	1.260	1.00
19_I	22_I	1.253	1.00
142_V	160_V	1.248	1.00
19_I	23_V	1.246	1.00
29_T	32_E	1.237	1.00
21_G	25_T	1.212	1.00
138_E	163_I	1.183	1.00
36_S	41_L	1.181	1.00
61_V	139_R	1.176	1.00
82_I	85_V	1.176	1.00
59_I	141_E	1.150	1.00
50_S	53_W	1.147	1.00
26_A	29_T	1.139	1.00
20_S	26_A	1.138	1.00
138_E	166_K	1.138	1.00
98_I	160_V	1.113	1.00
52_L	61_V	1.111	1.00
17_L	20_S	1.098	1.00
37_N	43_V	1.088	1.00
27_T	30_S	1.070	1.00
60_Q	82_I	1.068	1.00
19_I	25_T	1.067	1.00
143_V	147_Y	1.067	1.00
25_T	28_A	1.064	1.00
109_L	155_A	1.062	1.00
25_T	29_T	1.057	1.00
50_S	55_S	1.053	1.00
110_I	160_V	1.047	1.00
66_T	81_D	1.045	1.00
18_C	21_G	1.038	1.00
44_T	47_R	1.037	1.00
84_G	144_K	1.034	1.00
18_C	22_I	1.022	1.00
18_C	24_S	1.021	1.00
66_T	70_S	1.020	1.00
98_I	110_I	1.020	1.00
34_K	37_N	1.011	1.00
21_G	27_T	1.011	1.00
24_S	28_A	1.002	1.00
100_I	158_G	0.985	1.00
99_R	103_E	0.968	1.00
58_T	144_K	0.967	1.00
21_G	26_A	0.967	1.00
20_S	27_T	0.965	1.00
75_I	78_N	0.963	1.00
64_Q	67_L	0.962	1.00
72_N	77_D	0.958	1.00
151_Y	159_I	0.955	1.00
37_N	41_L	0.944	1.00
123_G	132_I	0.934	1.00
62_I	82_I	0.919	1.00
23_V	28_A	0.913	1.00
87_I	98_I	0.899	1.00
119_Y	123_G	0.897	1.00
23_V	29_T	0.897	1.00
33_T	36_S	0.890	1.00
31_S	34_K	0.890	1.00
83_P	144_K	0.888	1.00
140_V	162_F	0.883	1.00
25_T	31_S	0.883	1.00
19_I	24_S	0.880	1.00
85_V	98_I	0.873	1.00
103_E	107_R	0.872	1.00
114_G	161_N	0.867	1.00
22_I	26_A	0.867	1.00
118_T	154_Q	0.860	1.00
111_L	161_N	0.854	1.00
22_I	28_A	0.843	1.00
17_L	21_G	0.841	1.00
30_S	33_T	0.837	1.00
36_S	40_T	0.833	1.00
28_A	32_E	0.823	1.00
119_Y	122_A	0.817	1.00
52_L	59_I	0.810	1.00
111_L	159_I	0.806	1.00
39_E	42_V	0.804	1.00
104_A	107_R	0.804	1.00
139_R	161_N	0.783	1.00
99_R	107_R	0.781	1.00
26_A	31_S	0.781	1.00
22_I	27_T	0.771	1.00
38_E	43_V	0.768	1.00
112_I	132_I	0.765	1.00
89_D	96_K	0.765	1.00
24_S	29_T	0.755	1.00
26_A	30_S	0.752	1.00
92_L	95_R	0.739	1.00
97_Q	107_R	0.733	1.00
72_N	76_A	0.725	1.00
32_E	35_I	0.724	1.00
60_Q	83_P	0.724	1.00
33_T	37_N	0.722	1.00
21_G	28_A	0.713	1.00
78_N	134_E	0.707	1.00
109_L	154_Q	0.707	1.00
23_V	30_S	0.701	1.00
24_S	30_S	0.698	1.00
58_T	101_R	0.688	1.00
17_L	23_V	0.686	1.00
22_I	29_T	0.681	1.00
72_N	81_D	0.676	1.00
120_Q	123_G	0.669	1.00
27_T	32_E	0.667	1.00
18_C	23_V	0.660	1.00
76_A	96_K	0.660	1.00
100_I	108_V	0.659	1.00
77_D	96_K	0.644	1.00
22_I	31_S	0.644	1.00
24_S	31_S	0.643	1.00
20_S	28_A	0.641	1.00
19_I	27_T	0.636	1.00
103_E	106_S	0.635	1.00
68_Q	71_T	0.635	1.00
49_A	55_S	0.629	1.00
20_S	29_T	0.627	1.00
25_T	30_S	0.625	1.00
107_R	156_I	0.625	1.00
153_S	156_I	0.622	1.00
17_L	24_S	0.621	1.00
79_L	85_V	0.613	1.00
37_N	42_V	0.612	1.00
57_A	145_G	0.607	1.00
111_L	163_I	0.606	1.00
18_C	25_T	0.603	1.00
90_N	97_Q	0.598	1.00
100_I	144_K	0.598	1.00
40_T	43_V	0.597	1.00
56_P	145_G	0.593	1.00
141_E	163_I	0.593	1.00
134_E	137_L	0.593	1.00
23_V	31_S	0.591	1.00
35_I	39_E	0.589	1.00
75_I	140_V	0.589	1.00
118_T	122_A	0.581	1.00
72_N	134_E	0.580	1.00
132_I	137_L	0.578	1.00
111_L	151_Y	0.575	1.00
80_Q	87_I	0.573	1.00
44_T	49_A	0.565	1.00
26_A	32_E	0.564	1.00
86_E	99_R	0.562	1.00
107_R	157_G	0.561	1.00
21_G	29_T	0.560	1.00
35_I	38_E	0.556	1.00
17_L	26_A	0.553	1.00
34_K	38_E	0.550	1.00
18_C	26_A	0.547	1.00
19_I	26_A	0.543	1.00
25_T	32_E	0.541	1.00
35_I	40_T	0.541	1.00
90_N	95_R	0.539	1.00
108_V	157_G	0.528	1.00
143_V	159_I	0.527	1.00
78_N	82_I	0.526	1.00
88_T	97_Q	0.526	1.00
62_I	78_N	0.520	1.00
91_S	95_R	0.518	1.00
48_S	51_N	0.517	1.00
86_E	89_D	0.517	1.00
30_S	34_K	0.515	1.00
17_L	27_T	0.511	1.00
36_S	43_V	0.510	1.00
88_T	99_R	0.506	1.00
31_S	35_I	0.500	1.00
143_V	151_Y	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3fhhA	1	0.7605	100	0.178	Contact Map
2hdiA	1	0.7605	100	0.211	Contact Map
4epaA	1	0.6946	100	0.213	Contact Map
3v8xA	1	0.6766	100	0.219	Contact Map
4cu4A	1	0.8024	100	0.234	Contact Map
3cslA	1	0.6886	100	0.252	Contact Map
1fepA	1	0.7485	100	0.257	Contact Map
4b7oA	1	0.6826	100	0.265	Contact Map
2gufA	1	0.7665	100	0.265	Contact Map
1kmoA	1	0.7605	100	0.278	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.