MNTP - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MNTP - Probable manganese efflux pump MntP

UniProt:	P76264	Sequences: MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGMLASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAMAVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQILWTHFHG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14012
Length:	188 (178)
Sequences:	1930 (1555)
Seq/√Len:	116.6

ECOLI - MNTP
BACSU - MNTP YTAF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
74_F	182_L	5.031	1.00
86_I	90_R	3.706	1.00
83_R	86_I	3.637	1.00
18_F	151_G	3.433	1.00
48_T	141_G	3.366	1.00
42_I	112_A	2.921	1.00
88_G	168_I	2.817	1.00
48_T	137_A	2.515	1.00
42_I	108_L	2.512	1.00
75_V	79_F	2.406	1.00
172_L	176_G	2.292	1.00
81_G	171_G	2.282	1.00
36_A	40_G	2.102	1.00
52_L	137_A	2.077	1.00
82_G	86_I	2.072	1.00
139_A	143_A	2.051	1.00
38_R	105_F	1.964	1.00
81_G	175_I	1.960	1.00
17_A	144_T	1.946	1.00
22_I	151_G	1.927	1.00
22_I	154_V	1.904	1.00
10_A	139_A	1.892	1.00
154_V	158_I	1.855	1.00
24_K	111_T	1.823	1.00
132_N	135_A	1.822	1.00
7_V	139_A	1.804	1.00
147_M	151_G	1.803	1.00
6_T	139_A	1.769	1.00
85_I	171_G	1.765	1.00
83_R	87_E	1.747	1.00
42_I	105_F	1.728	1.00
13_M	118_D	1.726	1.00
21_S	148_S	1.707	1.00
175_I	178_G	1.700	1.00
32_K	35_E	1.698	1.00
11_F	147_M	1.646	1.00
7_V	143_A	1.623	1.00
6_T	136_T	1.557	1.00
14_S	147_M	1.546	1.00
81_G	178_G	1.523	1.00
79_F	83_R	1.500	1.00
10_A	143_A	1.487	1.00
65_V	69_N	1.453	1.00
31_P	36_A	1.446	1.00
41_L	45_A	1.441	1.00
62_S	66_L	1.434	1.00
46_V	50_T	1.403	1.00
69_N	73_A	1.373	1.00
119_A	140_I	1.372	1.00
78_I	82_G	1.370	1.00
153_M	157_F	1.369	1.00
179_V	183_W	1.360	1.00
14_S	143_A	1.357	1.00
39_T	108_L	1.343	1.00
6_T	10_A	1.315	1.00
154_V	162_I	1.306	1.00
34_S	38_R	1.296	1.00
9_L	177_I	1.293	1.00
31_P	35_E	1.252	0.99
65_V	72_I	1.248	0.99
36_A	152_M	1.246	0.99
14_S	43_F	1.231	0.99
47_E	115_T	1.227	0.99
73_A	181_I	1.224	0.99
40_G	145_L	1.172	0.99
51_P	140_I	1.159	0.99
43_F	47_E	1.158	0.99
18_F	125_G	1.146	0.99
155_G	159_G	1.143	0.99
9_L	126_L	1.135	0.99
123_G	155_G	1.125	0.99
17_A	51_P	1.121	0.99
157_F	160_S	1.111	0.99
39_T	103_H	1.111	0.99
158_I	162_I	1.104	0.98
46_V	116_S	1.095	0.98
14_S	144_T	1.089	0.98
164_K	168_I	1.077	0.98
23_G	40_G	1.077	0.98
74_F	78_I	1.077	0.98
26_A	158_I	1.070	0.98
5_A	22_I	1.056	0.98
47_E	119_A	1.055	0.98
64_F	67_E	1.050	0.98
44_G	144_T	1.049	0.98
85_I	168_I	1.041	0.98
73_A	77_L	1.031	0.98
144_T	148_S	1.003	0.97
35_E	38_R	1.003	0.97
94_D	98_E	0.994	0.97
76_L	181_I	0.982	0.97
45_A	49_L	0.975	0.97
12_G	15_M	0.969	0.97
48_T	133_I	0.968	0.96
53_I	113_I	0.954	0.96
28_L	103_H	0.951	0.96
42_I	141_G	0.951	0.96
78_I	178_G	0.943	0.96
12_G	170_G	0.942	0.96
134_I	138_L	0.937	0.96
24_K	103_H	0.932	0.96
138_L	142_C	0.928	0.96
15_M	148_S	0.913	0.95
47_E	140_I	0.913	0.95
38_R	108_L	0.909	0.95
105_F	108_L	0.907	0.95
43_F	140_I	0.898	0.95
104_G	107_L	0.878	0.94
29_H	107_L	0.874	0.94
23_G	144_T	0.872	0.94
44_G	141_G	0.850	0.93
132_N	136_T	0.849	0.93
24_K	107_L	0.849	0.93
12_G	148_S	0.843	0.93
10_A	14_S	0.836	0.92
138_L	180_Q	0.834	0.92
73_A	115_T	0.830	0.92
86_I	89_F	0.829	0.92
28_L	35_E	0.824	0.92
149_T	153_M	0.822	0.92
133_I	137_A	0.813	0.91
13_M	47_E	0.809	0.91
4_T	67_E	0.806	0.91
162_I	165_K	0.800	0.91
10_A	20_A	0.799	0.91
106_W	109_V	0.794	0.90
89_F	168_I	0.787	0.90
98_E	172_L	0.780	0.89
11_F	173_V	0.778	0.89
24_K	124_V	0.777	0.89
47_E	170_G	0.776	0.89
39_T	42_I	0.776	0.89
47_E	144_T	0.767	0.89
23_G	26_A	0.764	0.88
72_I	110_T	0.761	0.88
43_F	115_T	0.758	0.88
118_D	122_V	0.756	0.88
35_E	103_H	0.746	0.87
56_G	60_L	0.737	0.87
53_I	93_D	0.735	0.86
37_L	41_L	0.732	0.86
43_F	119_A	0.730	0.86
20_A	70_H	0.730	0.86
47_E	180_Q	0.727	0.86
4_T	158_I	0.715	0.85
161_I	165_K	0.714	0.85
24_K	127_A	0.712	0.85
144_T	181_I	0.704	0.84
80_L	136_T	0.702	0.84
63_R	66_L	0.698	0.84
21_S	152_M	0.695	0.83
3_I	135_A	0.694	0.83
32_K	63_R	0.694	0.83
84_M	170_G	0.689	0.83
62_S	124_V	0.682	0.82
3_I	53_I	0.681	0.82
14_S	17_A	0.678	0.82
66_L	69_N	0.678	0.82
115_T	119_A	0.677	0.82
131_V	136_T	0.672	0.81
7_V	72_I	0.672	0.81
47_E	50_T	0.668	0.81
114_A	177_I	0.667	0.81
110_T	173_V	0.666	0.81
15_M	19_A	0.666	0.81
33_F	150_L	0.666	0.81
46_V	140_I	0.665	0.81
82_G	89_F	0.661	0.80
17_A	46_V	0.660	0.80
75_V	138_L	0.659	0.80
70_H	76_L	0.657	0.80
12_G	161_I	0.654	0.79
20_A	47_E	0.654	0.79
47_E	118_D	0.651	0.79
20_A	80_L	0.650	0.79
175_I	179_V	0.649	0.79
17_A	119_A	0.647	0.79
135_A	139_A	0.646	0.79
5_A	161_I	0.645	0.78
136_T	140_I	0.645	0.78
71_W	85_I	0.639	0.78
85_I	88_G	0.638	0.78
4_T	8_L	0.638	0.78
94_D	99_P	0.636	0.78
11_F	145_L	0.632	0.77
17_A	44_G	0.632	0.77
53_I	149_T	0.632	0.77
79_F	102_R	0.631	0.77
112_A	137_A	0.624	0.76
10_A	148_S	0.623	0.76
42_I	45_A	0.621	0.76
13_M	17_A	0.620	0.76
39_T	107_L	0.617	0.75
4_T	130_Q	0.617	0.75
109_V	148_S	0.614	0.75
19_A	47_E	0.610	0.75
107_L	114_A	0.610	0.75
124_V	133_I	0.609	0.74
74_F	115_T	0.607	0.74
130_Q	179_V	0.603	0.74
53_I	150_L	0.603	0.74
71_W	182_L	0.602	0.74
100_R	103_H	0.602	0.74
174_L	178_G	0.600	0.73
40_G	149_T	0.599	0.73
25_G	151_G	0.599	0.73
10_A	147_M	0.597	0.73
13_M	46_V	0.595	0.73
76_L	84_M	0.592	0.72
65_V	128_F	0.591	0.72
74_F	178_G	0.585	0.71
35_E	108_L	0.584	0.71
41_L	56_G	0.584	0.71
19_A	165_K	0.581	0.71
17_A	118_D	0.580	0.71
98_E	183_W	0.579	0.71
21_S	36_A	0.578	0.71
36_A	149_T	0.577	0.70
8_L	177_I	0.575	0.70
14_S	118_D	0.570	0.70
69_N	77_L	0.570	0.70
22_I	58_G	0.569	0.69
47_E	148_S	0.569	0.69
18_F	22_I	0.569	0.69
57_M	124_V	0.567	0.69
120_M	124_V	0.559	0.68
91_G	138_L	0.555	0.67
78_I	89_F	0.551	0.67
42_I	109_V	0.550	0.67
78_I	145_L	0.548	0.67
63_R	67_E	0.545	0.66
47_E	84_M	0.543	0.66
17_A	43_F	0.543	0.66
78_I	175_I	0.541	0.66
7_V	153_M	0.540	0.65
125_G	128_F	0.537	0.65
19_A	80_L	0.537	0.65
37_L	49_L	0.536	0.65
71_W	75_V	0.533	0.64
59_M	169_L	0.533	0.64
61_A	117_L	0.531	0.64
27_T	38_R	0.531	0.64
71_W	74_F	0.527	0.64
176_G	183_W	0.527	0.64
8_L	80_L	0.527	0.64
104_G	139_A	0.523	0.63
50_T	115_T	0.523	0.63
30_K	34_S	0.522	0.63
43_F	112_A	0.521	0.63
29_H	101_R	0.520	0.63
71_W	76_L	0.518	0.62
83_R	120_M	0.516	0.62
129_L	181_I	0.515	0.62
98_E	107_L	0.515	0.62
85_I	165_K	0.512	0.61
12_G	119_A	0.511	0.61
119_A	170_G	0.510	0.61
33_F	138_L	0.509	0.61
91_G	117_L	0.507	0.61
100_R	104_G	0.506	0.60
43_F	121_A	0.504	0.60
65_V	121_A	0.503	0.60
19_A	74_F	0.502	0.60
85_I	161_I	0.501	0.60
38_R	104_G	0.501	0.60
83_R	115_T	0.500	0.60
115_T	170_G	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2cfqA	1	0.9681	27.6	0.93	Contact Map
3wdoA	1	0.9468	20.4	0.934	Contact Map
3j1zP	8	0.5	17.5	0.936	Contact Map
2gfpA	2	0.9681	16.9	0.937	Contact Map
1pw4A	1	0.5532	15.7	0.938	Contact Map
4p6vD	1	0.7713	12.1	0.94	Contact Map
4m64A	1	0.9894	12.1	0.941	Contact Map
4j05A	3	0.883	11.6	0.941	Contact Map
3o7qA	1	0.9734	10.9	0.942	Contact Map
4w6vA	1	0.4947	9.9	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.