YEAO - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YEAO - Uncharacterized protein YeaO

UniProt:	P76243	Sequences: MNIQCKRVYDPAEQSDGYRILVDRLWPRGIKKTDLALDEWDKEITPSTELRKAFHGEVVDYATFREQYLAELAQHEQEGKRLADIAKKQPLTLLYSAKNTTQNHALVLADWLRSL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13501
Length:	115 (111)
Sequences:	1532 (1172)
Seq/√Len:	111.2

ECOLI - YEAO
SULSO - Q97X88

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
109_A	113_R	3.482	1.00
8_V	94_L	3.330	1.00
31_K	34_D	2.607	1.00
99_N	102_Q	2.543	1.00
57_E	60_D	2.450	1.00
53_A	67_Q	2.353	1.00
6_K	16_D	2.350	1.00
65_R	110_D	2.215	1.00
69_L	107_V	2.161	1.00
8_V	35_L	2.112	1.00
6_K	92_T	1.950	1.00
65_R	69_L	1.895	1.00
48_T	104_H	1.867	1.00
16_D	92_T	1.859	1.00
73_A	111_W	1.836	1.00
103_N	106_L	1.809	1.00
79_G	111_W	1.774	1.00
95_Y	103_N	1.738	1.00
10_D	100_T	1.721	1.00
4_Q	90_P	1.714	1.00
93_L	112_L	1.684	1.00
48_T	52_K	1.596	1.00
23_D	104_H	1.548	1.00
56_G	60_D	1.543	1.00
61_Y	65_R	1.512	1.00
18_Y	39_E	1.455	1.00
39_E	81_R	1.445	1.00
55_H	60_D	1.403	1.00
45_T	104_H	1.389	1.00
63_T	67_Q	1.372	1.00
61_Y	107_V	1.358	1.00
18_Y	38_D	1.320	1.00
5_C	105_A	1.304	0.99
50_L	53_A	1.272	0.99
31_K	35_L	1.218	0.99
8_V	30_I	1.202	0.99
41_D	45_T	1.193	0.99
95_Y	100_T	1.179	0.99
104_H	107_V	1.177	0.99
17_G	92_T	1.171	0.99
47_S	71_E	1.166	0.99
6_K	19_R	1.164	0.99
18_Y	89_Q	1.163	0.99
53_A	60_D	1.161	0.99
54_F	102_Q	1.143	0.99
53_A	59_V	1.142	0.99
95_Y	105_A	1.141	0.99
78_E	81_R	1.134	0.99
96_S	104_H	1.119	0.98
37_L	94_L	1.109	0.98
97_A	103_N	1.099	0.98
100_T	103_N	1.089	0.98
86_A	91_L	1.089	0.98
80_K	83_A	1.065	0.98
81_R	85_I	1.056	0.98
20_I	85_I	1.054	0.98
16_D	19_R	1.032	0.97
3_I	91_L	1.030	0.97
25_L	104_H	1.024	0.97
41_D	44_I	1.014	0.97
6_K	17_G	1.008	0.97
63_T	66_E	1.008	0.97
70_A	74_Q	0.973	0.96
54_F	95_Y	0.973	0.96
32_K	98_K	0.972	0.96
81_R	84_D	0.970	0.96
23_D	96_S	0.953	0.96
54_F	103_N	0.924	0.95
5_C	109_A	0.921	0.95
18_Y	85_I	0.917	0.95
30_I	35_L	0.912	0.94
56_G	97_A	0.904	0.94
23_D	98_K	0.899	0.94
21_L	35_L	0.889	0.94
95_Y	106_L	0.881	0.93
12_A	16_D	0.879	0.93
20_I	39_E	0.869	0.93
82_L	86_A	0.859	0.92
20_I	82_L	0.858	0.92
3_I	86_A	0.852	0.92
25_L	51_R	0.850	0.92
44_I	78_E	0.842	0.92
85_I	89_Q	0.835	0.91
70_A	73_A	0.815	0.90
58_V	99_N	0.810	0.90
8_V	37_L	0.797	0.89
75_H	78_E	0.785	0.89
52_K	98_K	0.768	0.88
49_E	52_K	0.753	0.86
53_A	63_T	0.748	0.86
45_T	56_G	0.745	0.86
83_A	86_A	0.744	0.86
61_Y	106_L	0.742	0.86
21_L	27_P	0.737	0.85
54_F	100_T	0.737	0.85
56_G	59_V	0.734	0.85
81_R	86_A	0.731	0.85
54_F	97_A	0.726	0.84
4_Q	15_S	0.720	0.84
79_G	83_A	0.709	0.83
69_L	110_D	0.707	0.83
60_D	63_T	0.704	0.83
13_E	16_D	0.689	0.81
80_K	84_D	0.683	0.81
14_Q	36_A	0.681	0.80
16_D	90_P	0.674	0.80
20_I	41_D	0.662	0.79
78_E	86_A	0.659	0.78
34_D	77_Q	0.658	0.78
6_K	12_A	0.652	0.78
95_Y	99_N	0.648	0.77
56_G	102_Q	0.645	0.77
94_L	105_A	0.634	0.76
77_Q	80_K	0.631	0.75
97_A	105_A	0.631	0.75
31_K	37_L	0.628	0.75
20_I	81_R	0.627	0.75
58_V	102_Q	0.626	0.75
24_R	48_T	0.625	0.75
9_Y	100_T	0.625	0.75
35_L	38_D	0.623	0.74
6_K	13_E	0.619	0.74
61_Y	103_N	0.616	0.73
11_P	22_V	0.615	0.73
50_L	63_T	0.612	0.73
33_T	36_A	0.612	0.73
25_L	48_T	0.608	0.73
78_E	82_L	0.607	0.72
66_E	70_A	0.605	0.72
12_A	92_T	0.603	0.72
11_P	19_R	0.602	0.72
19_R	37_L	0.597	0.71
77_Q	81_R	0.593	0.71
106_L	109_A	0.589	0.70
23_D	93_L	0.588	0.70
53_A	57_E	0.588	0.70
62_A	76_E	0.587	0.70
32_K	51_R	0.587	0.70
79_G	82_L	0.586	0.70
61_Y	102_Q	0.574	0.68
107_V	111_W	0.570	0.68
18_Y	41_D	0.566	0.67
82_L	91_L	0.563	0.67
15_S	90_P	0.563	0.67
69_L	73_A	0.562	0.67
86_A	90_P	0.562	0.67
22_V	108_L	0.561	0.66
48_T	54_F	0.556	0.66
100_T	106_L	0.556	0.66
86_A	93_L	0.550	0.65
37_L	91_L	0.548	0.65
21_L	37_L	0.547	0.64
41_D	81_R	0.545	0.64
23_D	97_A	0.540	0.63
32_K	52_K	0.538	0.63
50_L	67_Q	0.533	0.62
22_V	105_A	0.531	0.62
30_I	94_L	0.531	0.62
25_L	42_K	0.531	0.62
20_I	91_L	0.531	0.62
69_L	111_W	0.525	0.61
110_D	113_R	0.516	0.60
75_H	111_W	0.514	0.60
32_K	42_K	0.508	0.59
8_V	26_W	0.506	0.59
15_S	92_T	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1v54E	1	0.5043	23.3	0.938	Contact Map
2cxnA	2	0.7652	19.4	0.94	Contact Map
2gqrA	2	0.5391	14.7	0.943	Contact Map
2xmoA	1	0.9478	9.1	0.948	Contact Map
4bkyA	1	0.3826	8.3	0.949	Contact Map
3ljkA	2	0.7304	8.2	0.949	Contact Map
3uemA	1	0.5304	7.6	0.95	Contact Map
2ywvA	2	0.5217	6.7	0.951	Contact Map
4l6hA	1	0.9478	6.3	0.952	Contact Map
2y69E	1	0.4957	6.2	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.