YDIQ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YDIQ - Putative electron transfer flavoprotein subunit YdiQ

UniProt:	P76201	Sequences: MKIITCFKLVPEEQDIVVTPEYTLNFDNADAKISQFDLNAIEAASQLATDDDEIAALTVGGSLLQNSKVRKDVLSRGPHSLYLVQDAQLEHALPLDTAKALAAAIEKIGFDLLIFGEGSGDLYAQQVGLLVGEILQLPVINAVSAIQRQGNTLVIERTLEDDVEVIELSVPAVLCVTSDINVPRIPSMKAILGAGKKPVNQWQASDIDWSQSAPLAELVGIRVPPQTERKHIIIDNDSPEAIAELAEHLKKALN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13976
Length:	254 (240)
Sequences:	3510 (2042)
Seq/√Len:	131.8

ECOLI - YDIQ FIXA YGCR
BACSU - ETFB
HALSA - Q9HND3
SULSO - Q97V19 Q97V71

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
152_T	167_E	4.160	1.00
53_E	80_S	3.621	1.00
128_G	175_C	3.351	1.00
103_A	106_E	3.225	1.00
48_A	79_H	3.217	1.00
70_R	81_L	3.113	1.00
145_A	156_E	2.947	1.00
203_Q	206_D	2.918	1.00
107_K	202_W	2.915	1.00
43_A	46_Q	2.649	1.00
56_A	73_V	2.625	1.00
80_S	200_N	2.586	1.00
247_E	251_K	2.532	1.00
2_K	53_E	2.381	1.00
74_L	81_L	2.347	1.00
140_I	168_L	2.326	1.00
115_F	131_V	2.300	1.00
43_A	181_N	2.232	1.00
143_V	155_I	2.117	1.00
49_T	184_R	2.117	1.00
33_I	69_V	2.075	1.00
42_E	184_R	2.047	1.00
143_V	174_L	2.019	1.00
4_I	105_I	1.992	1.00
154_V	167_E	1.986	1.00
168_L	172_A	1.981	1.00
153_L	168_L	1.962	1.00
157_R	164_E	1.959	1.00
41_I	78_P	1.926	1.00
6_C	115_F	1.885	1.00
55_A	82_Y	1.884	1.00
102_A	106_E	1.866	1.00
34_S	37_D	1.773	1.00
147_Q	154_V	1.771	1.00
84_V	100_A	1.746	1.00
113_L	137_L	1.726	1.00
98_A	134_I	1.718	1.00
118_G	123_Y	1.699	1.00
112_L	172_A	1.697	1.00
58_T	64_L	1.688	1.00
241_A	244_E	1.682	1.00
55_A	80_S	1.678	1.00
65_Q	71_K	1.659	1.00
4_I	110_F	1.632	1.00
153_L	170_V	1.622	1.00
156_E	165_V	1.619	1.00
148_R	153_L	1.613	1.00
176_V	180_I	1.613	1.00
244_E	247_E	1.604	1.00
240_E	244_E	1.583	1.00
56_A	78_P	1.576	1.00
54_I	78_P	1.569	1.00
107_K	200_N	1.550	1.00
92_A	100_A	1.544	1.00
62_S	85_Q	1.503	1.00
84_V	104_A	1.480	1.00
50_D	147_Q	1.477	1.00
187_S	190_A	1.467	1.00
105_I	113_L	1.440	1.00
85_Q	201_Q	1.423	1.00
132_G	139_V	1.420	1.00
57_L	104_A	1.415	1.00
82_Y	104_A	1.377	1.00
61_G	64_L	1.376	1.00
154_V	165_V	1.308	1.00
44_A	54_I	1.307	1.00
83_L	201_Q	1.277	1.00
3_I	51_D	1.270	1.00
2_K	55_A	1.258	1.00
152_T	169_S	1.256	1.00
55_A	110_F	1.253	1.00
151_N	169_S	1.242	1.00
65_Q	201_Q	1.240	1.00
137_L	173_V	1.238	1.00
119_S	122_L	1.219	1.00
56_A	70_R	1.216	1.00
74_L	197_K	1.210	1.00
144_S	156_E	1.210	1.00
55_A	108_I	1.200	0.99
149_Q	154_V	1.195	0.99
243_A	246_A	1.184	0.99
43_A	180_I	1.172	0.99
39_N	181_N	1.145	0.99
101_L	131_V	1.143	0.99
111_D	151_N	1.141	0.99
99_K	103_A	1.139	0.99
51_D	54_I	1.136	0.99
58_T	83_L	1.133	0.99
19_T	22_Y	1.131	0.99
202_W	207_I	1.130	0.99
80_S	108_I	1.127	0.99
107_K	207_I	1.121	0.99
43_A	146_I	1.113	0.99
99_K	134_I	1.105	0.99
156_E	163_V	1.102	0.99
33_I	73_V	1.097	0.99
189_K	193_G	1.096	0.99
82_Y	202_W	1.094	0.99
41_I	76_R	1.088	0.99
105_I	131_V	1.078	0.99
45_S	190_A	1.078	0.99
148_R	170_V	1.063	0.99
102_A	135_L	1.042	0.99
17_V	25_N	1.041	0.99
42_E	46_Q	1.040	0.99
48_A	52_D	1.039	0.98
7_F	41_I	1.036	0.98
233_I	241_A	1.032	0.98
45_S	76_R	1.027	0.98
85_Q	203_Q	1.024	0.98
86_D	92_A	1.024	0.98
242_I	246_A	1.018	0.98
7_F	73_V	1.017	0.98
204_A	209_W	1.014	0.98
96_D	214_P	1.012	0.98
36_F	117_E	1.010	0.98
191_I	197_K	1.009	0.98
149_Q	152_T	1.005	0.98
9_L	69_V	1.000	0.98
114_I	174_L	0.997	0.98
42_E	183_P	0.987	0.98
140_I	155_I	0.985	0.98
146_I	155_I	0.984	0.98
62_S	65_Q	0.983	0.98
4_I	57_L	0.981	0.98
129_L	139_V	0.972	0.98
138_P	172_A	0.971	0.98
102_A	131_V	0.966	0.98
95_L	99_K	0.951	0.97
39_N	179_D	0.947	0.97
25_N	28_N	0.940	0.97
6_C	131_V	0.936	0.97
100_A	207_I	0.931	0.97
192_L	195_G	0.931	0.97
38_L	76_R	0.931	0.97
103_A	207_I	0.930	0.97
130_L	134_I	0.927	0.97
43_A	145_A	0.923	0.97
223_V	226_Q	0.923	0.97
114_I	176_V	0.922	0.97
189_K	192_L	0.921	0.97
125_Q	129_L	0.912	0.97
159_L	162_D	0.908	0.96
65_Q	83_L	0.908	0.96
113_L	131_V	0.907	0.96
7_F	69_V	0.906	0.96
4_I	108_I	0.897	0.96
231_H	248_H	0.893	0.96
248_H	251_K	0.890	0.96
45_S	49_T	0.886	0.96
93_L	215_L	0.884	0.96
100_A	204_A	0.879	0.96
59_V	97_T	0.877	0.96
64_L	83_L	0.876	0.96
7_F	56_A	0.872	0.96
76_R	183_P	0.864	0.95
38_L	72_D	0.859	0.95
185_I	191_I	0.859	0.95
40_A	176_V	0.859	0.95
87_A	90_E	0.853	0.95
227_T	230_K	0.851	0.95
146_I	153_L	0.850	0.95
103_A	107_K	0.849	0.95
72_D	76_R	0.847	0.95
117_E	123_Y	0.846	0.95
210_S	213_A	0.845	0.95
110_F	137_L	0.843	0.95
231_H	244_E	0.842	0.95
205_S	208_D	0.839	0.95
119_S	123_Y	0.838	0.95
98_A	130_L	0.836	0.94
26_F	61_G	0.830	0.94
49_T	52_D	0.830	0.94
86_D	204_A	0.826	0.94
43_A	50_D	0.826	0.94
204_A	211_Q	0.825	0.94
140_I	166_I	0.824	0.94
5_T	54_I	0.824	0.94
129_L	141_N	0.820	0.94
244_E	248_H	0.815	0.94
94_P	130_L	0.813	0.94
115_F	173_V	0.812	0.94
13_E	32_K	0.809	0.93
105_I	110_F	0.808	0.93
133_E	139_V	0.799	0.93
82_Y	108_I	0.798	0.93
105_I	135_L	0.796	0.93
228_E	231_H	0.795	0.93
103_A	208_D	0.794	0.93
82_Y	200_N	0.793	0.93
61_G	83_L	0.789	0.93
117_E	178_S	0.786	0.92
158_T	179_D	0.781	0.92
210_S	214_P	0.781	0.92
92_A	96_D	0.773	0.92
108_I	202_W	0.770	0.92
81_L	199_V	0.763	0.91
104_A	202_W	0.761	0.91
6_C	101_L	0.758	0.91
76_R	186_P	0.755	0.91
40_A	114_I	0.753	0.91
147_Q	156_E	0.751	0.91
36_F	39_N	0.749	0.90
59_V	84_V	0.748	0.90
218_L	221_I	0.748	0.90
124_A	216_A	0.747	0.90
46_Q	184_R	0.743	0.90
139_V	173_V	0.743	0.90
32_K	120_G	0.742	0.90
33_I	38_L	0.739	0.90
149_Q	167_E	0.734	0.90
39_N	177_T	0.731	0.89
202_W	206_D	0.728	0.89
6_C	105_I	0.722	0.89
71_K	195_G	0.722	0.89
193_G	197_K	0.713	0.88
11_P	26_F	0.713	0.88
153_L	174_L	0.712	0.88
104_A	108_I	0.708	0.88
44_A	114_I	0.705	0.88
194_A	197_K	0.703	0.88
93_L	96_D	0.694	0.87
117_E	177_T	0.693	0.87
41_I	56_A	0.693	0.87
57_L	101_L	0.691	0.87
229_R	232_I	0.690	0.87
217_E	220_G	0.690	0.87
12_E	32_K	0.690	0.87
106_E	136_Q	0.685	0.86
192_L	196_K	0.682	0.86
65_Q	199_V	0.681	0.86
140_I	153_L	0.681	0.86
131_V	173_V	0.680	0.86
84_V	207_I	0.677	0.85
105_I	109_G	0.674	0.85
146_I	174_L	0.674	0.85
119_S	124_A	0.672	0.85
106_E	109_G	0.671	0.85
95_L	215_L	0.667	0.85
34_S	120_G	0.660	0.84
31_A	63_L	0.659	0.84
243_A	247_E	0.658	0.84
157_R	166_I	0.658	0.84
41_I	45_S	0.657	0.84
94_P	126_Q	0.653	0.83
46_Q	49_T	0.651	0.83
86_D	91_H	0.651	0.83
9_L	31_A	0.651	0.83
75_S	190_A	0.650	0.83
95_L	134_I	0.650	0.83
5_T	44_A	0.646	0.83
37_D	122_L	0.644	0.83
3_I	54_I	0.643	0.82
155_I	172_A	0.642	0.82
41_I	176_V	0.641	0.82
59_V	92_A	0.640	0.82
59_V	101_L	0.639	0.82
112_L	153_L	0.638	0.82
120_G	123_Y	0.638	0.82
33_I	72_D	0.637	0.82
230_K	233_I	0.635	0.82
70_R	83_L	0.634	0.82
23_T	218_L	0.633	0.81
42_E	49_T	0.633	0.81
97_T	122_L	0.629	0.81
93_L	214_P	0.628	0.81
93_L	216_A	0.628	0.81
94_P	122_L	0.627	0.81
117_E	142_A	0.623	0.80
59_V	93_L	0.622	0.80
142_A	177_T	0.619	0.80
92_A	213_A	0.618	0.80
25_N	29_A	0.617	0.80
37_D	124_A	0.612	0.79
8_K	58_T	0.612	0.79
57_L	108_I	0.612	0.79
145_A	165_V	0.608	0.79
158_T	177_T	0.608	0.79
232_I	244_E	0.607	0.79
105_I	137_L	0.606	0.79
47_L	112_L	0.606	0.79
11_P	29_A	0.603	0.78
36_F	123_Y	0.602	0.78
112_L	174_L	0.601	0.78
129_L	175_C	0.600	0.78
115_F	128_G	0.599	0.78
5_T	40_A	0.596	0.77
92_A	214_P	0.596	0.77
159_L	164_E	0.593	0.77
95_L	128_G	0.593	0.77
138_P	168_L	0.593	0.77
100_A	104_A	0.591	0.77
132_G	173_V	0.588	0.77
114_I	146_I	0.587	0.76
26_F	59_V	0.586	0.76
13_E	35_Q	0.584	0.76
224_P	245_L	0.584	0.76
105_I	173_V	0.583	0.76
37_D	69_V	0.582	0.76
188_M	195_G	0.582	0.76
41_I	73_V	0.578	0.75
12_E	30_D	0.578	0.75
9_L	63_L	0.577	0.75
110_F	113_L	0.576	0.75
96_D	213_A	0.575	0.75
61_G	91_H	0.573	0.75
73_V	78_P	0.573	0.75
19_T	25_N	0.572	0.75
112_L	170_V	0.571	0.74
106_E	135_L	0.567	0.74
75_S	194_A	0.566	0.74
70_R	199_V	0.564	0.74
47_L	114_I	0.561	0.73
9_L	60_G	0.561	0.73
20_P	25_N	0.560	0.73
2_K	110_F	0.560	0.73
143_V	146_I	0.560	0.73
228_E	232_I	0.557	0.73
22_Y	26_F	0.556	0.72
3_I	6_C	0.556	0.72
23_T	26_F	0.556	0.72
194_A	224_P	0.554	0.72
210_S	215_L	0.553	0.72
52_D	111_D	0.552	0.72
92_A	97_T	0.549	0.72
126_Q	130_L	0.549	0.72
99_K	209_W	0.547	0.71
39_N	158_T	0.547	0.71
225_P	229_R	0.546	0.71
30_D	188_M	0.544	0.71
19_T	23_T	0.543	0.71
144_S	158_T	0.540	0.70
168_L	174_L	0.538	0.70
35_Q	123_Y	0.534	0.69
33_I	41_I	0.533	0.69
118_G	125_Q	0.532	0.69
45_S	54_I	0.531	0.69
71_K	198_P	0.530	0.69
182_V	191_I	0.529	0.69
39_N	178_S	0.527	0.68
107_K	206_D	0.526	0.68
100_A	211_Q	0.526	0.68
198_P	247_E	0.521	0.68
117_E	179_D	0.519	0.67
35_Q	120_G	0.518	0.67
214_P	218_L	0.517	0.67
86_D	90_E	0.516	0.67
63_L	68_K	0.515	0.67
45_S	73_V	0.515	0.67
40_A	116_G	0.514	0.67
76_R	196_K	0.512	0.66
102_A	134_I	0.510	0.66
118_G	224_P	0.510	0.66
94_P	124_A	0.510	0.66
58_T	70_R	0.507	0.65
3_I	114_I	0.504	0.65
71_K	197_K	0.503	0.65
155_I	165_V	0.502	0.65
123_Y	139_V	0.502	0.65
35_Q	117_E	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4l2iB	1	0.9882	100	0.198	Contact Map
1o97C	1	0.937	100	0.2	Contact Map
1efpB	1	0.9449	100	0.224	Contact Map
1efvB	1	0.9646	100	0.243	Contact Map
3ih5A	6	0.7756	100	0.614	Contact Map
4l2iA	1	0.8937	100	0.617	Contact Map
1o97D	1	0.8346	100	0.629	Contact Map
1efvA	1	0.8307	99.9	0.656	Contact Map
1efpA	1	0.811	99.9	0.659	Contact Map
3fetA	2	0.6417	99.9	0.683	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.