COHE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COHE - Putative lambdoid prophage e14 repressor protein C2

UniProt:	P75974	Sequences: MKTIHDIRRSNARKLRDGVGGNSSFATMIDREPTQTSRFMGDGATKNIGDSMARHIEKCFDLPVGWLDQEHQTTNITKKPDVSITNKQITLVPVISWVQAGAWKEVGYSEVDLSTAETYPCPVPCGEMTYILRVIGDSMIDEYRPGDMIFVDPEVPACHGDDVIALMHDTGETTFKRLIEDGTQRYLKALNPNWPEPYIKINGNCSIIGTVIFSGKPRRYKIKA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14249
Length:	224 (197)
Sequences:	6334 (4829)
Seq/√Len:	344.1

ECOLI - COHE LEXA UMUD
BACSU - LEXA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_R	40_M	4.586	1.00
177_R	190_L	4.144	1.00
142_E	190_L	3.021	1.00
98_V	164_I	2.812	1.00
144_R	147_D	2.746	1.00
100_A	134_V	2.729	1.00
15_L	19_V	2.691	1.00
23_S	27_T	2.442	1.00
184_Q	198_Y	2.432	1.00
131_I	148_M	2.353	1.00
137_D	194_W	2.333	1.00
149_I	175_F	2.287	1.00
141_D	192_P	2.244	1.00
179_I	188_K	2.183	1.00
166_L	206_S	2.118	1.00
23_S	33_P	2.057	1.00
66_W	70_E	2.001	1.00
97_W	135_I	1.983	1.00
131_I	150_F	1.940	1.00
181_D	186_Y	1.897	1.00
92_V	131_I	1.827	1.00
188_K	196_E	1.826	1.00
161_D	210_T	1.816	1.00
128_M	153_P	1.792	1.00
39_F	46_K	1.789	1.00
137_D	193_N	1.733	1.00
168_H	204_N	1.703	1.00
175_F	211_V	1.691	1.00
157_A	163_V	1.690	1.00
29_I	59_C	1.683	1.00
28_M	59_C	1.679	1.00
14_K	18_G	1.625	1.00
21_G	24_S	1.616	1.00
134_V	149_I	1.613	1.00
34_T	38_R	1.609	1.00
24_S	28_M	1.604	1.00
22_N	33_P	1.587	1.00
33_P	37_S	1.562	1.00
32_E	35_Q	1.552	1.00
179_I	186_Y	1.532	1.00
38_R	43_G	1.530	1.00
174_T	189_A	1.520	1.00
134_V	143_Y	1.504	1.00
143_Y	162_D	1.471	1.00
52_M	55_H	1.462	1.00
13_R	40_M	1.425	1.00
176_K	189_A	1.413	1.00
24_S	27_T	1.405	1.00
133_R	148_M	1.388	1.00
15_L	18_G	1.384	1.00
130_Y	153_P	1.366	1.00
140_I	144_R	1.365	1.00
165_A	187_L	1.358	1.00
119_Y	122_P	1.342	1.00
136_G	145_P	1.341	1.00
138_S	176_K	1.340	1.00
25_F	36_T	1.334	1.00
22_N	40_M	1.330	1.00
151_V	211_V	1.328	1.00
165_A	178_L	1.309	1.00
38_R	44_A	1.306	1.00
162_D	177_R	1.260	1.00
186_Y	198_Y	1.258	1.00
39_F	52_M	1.248	1.00
19_V	61_D	1.243	1.00
134_V	175_F	1.231	1.00
98_V	132_L	1.219	1.00
57_E	62_L	1.215	1.00
117_E	120_P	1.214	1.00
31_R	35_Q	1.210	1.00
63_P	66_W	1.196	1.00
22_N	37_S	1.196	1.00
32_E	38_R	1.194	1.00
174_T	197_P	1.186	1.00
128_M	154_E	1.168	1.00
16_R	20_G	1.164	1.00
35_Q	38_R	1.157	1.00
15_L	60_F	1.140	1.00
31_R	36_T	1.138	1.00
36_T	39_F	1.135	1.00
55_H	58_K	1.135	1.00
101_G	176_K	1.134	1.00
149_I	211_V	1.125	1.00
186_Y	196_E	1.106	1.00
199_I	205_C	1.096	1.00
99_Q	103_W	1.092	1.00
39_F	56_I	1.085	1.00
35_Q	39_F	1.085	1.00
44_A	47_N	1.080	1.00
37_S	41_G	1.078	1.00
31_R	52_M	1.076	1.00
34_T	37_S	1.070	1.00
15_L	62_L	1.070	1.00
31_R	39_F	1.067	1.00
141_D	190_L	1.062	1.00
26_A	29_I	1.058	1.00
166_L	208_I	1.056	1.00
68_D	71_H	1.055	1.00
20_G	24_S	1.033	1.00
25_F	56_I	1.028	1.00
187_L	197_P	1.010	1.00
16_R	25_F	1.004	1.00
127_E	152_D	1.000	1.00
64_V	68_D	0.991	1.00
129_T	153_P	0.989	1.00
19_V	28_M	0.979	1.00
66_W	69_Q	0.979	1.00
39_F	47_N	0.978	1.00
129_T	212_I	0.977	1.00
57_E	67_L	0.976	1.00
151_V	164_I	0.975	1.00
181_D	184_Q	0.975	1.00
16_R	22_N	0.973	1.00
67_L	71_H	0.972	1.00
62_L	66_W	0.957	1.00
65_G	68_D	0.954	1.00
129_T	150_F	0.951	1.00
163_V	178_L	0.950	1.00
97_W	133_R	0.947	1.00
94_V	131_I	0.944	1.00
177_R	188_K	0.938	1.00
164_I	175_F	0.925	1.00
120_P	123_V	0.922	1.00
13_R	17_D	0.915	1.00
115_T	119_Y	0.915	1.00
54_R	64_V	0.912	1.00
150_F	213_F	0.910	1.00
136_G	176_K	0.901	1.00
116_A	119_Y	0.898	1.00
75_N	79_K	0.896	1.00
54_R	58_K	0.884	1.00
189_A	196_E	0.884	1.00
98_V	175_F	0.880	1.00
142_E	162_D	0.871	1.00
62_L	67_L	0.859	1.00
19_V	60_F	0.859	1.00
44_A	51_S	0.845	1.00
57_E	65_G	0.844	1.00
72_Q	81_D	0.843	1.00
135_I	145_P	0.837	1.00
42_D	46_K	0.835	1.00
51_S	55_H	0.832	1.00
163_V	210_T	0.823	1.00
167_M	199_I	0.820	1.00
143_Y	214_S	0.820	1.00
167_M	172_E	0.814	1.00
101_G	136_G	0.813	1.00
26_A	33_P	0.813	1.00
75_N	78_K	0.810	1.00
29_I	52_M	0.807	1.00
82_V	86_N	0.806	1.00
142_E	177_R	0.805	1.00
115_T	118_T	0.803	1.00
72_Q	75_N	0.799	1.00
118_T	122_P	0.799	1.00
160_G	179_I	0.797	1.00
43_G	47_N	0.792	1.00
20_G	40_M	0.789	1.00
22_N	36_T	0.787	1.00
12_A	15_L	0.784	1.00
143_Y	175_F	0.783	1.00
83_S	86_N	0.781	1.00
36_T	40_M	0.781	1.00
202_N	205_C	0.779	1.00
157_A	178_L	0.778	1.00
159_H	179_I	0.778	1.00
72_Q	79_K	0.768	1.00
166_L	169_D	0.765	1.00
32_E	37_S	0.764	1.00
54_R	57_E	0.758	1.00
12_A	40_M	0.757	1.00
20_G	28_M	0.753	1.00
76_I	81_D	0.753	1.00
162_D	190_L	0.752	1.00
155_V	206_S	0.752	1.00
20_G	59_C	0.746	1.00
94_V	133_R	0.742	1.00
53_A	64_V	0.738	0.99
137_D	140_I	0.725	0.99
31_R	34_T	0.723	0.99
132_L	164_I	0.721	0.99
114_S	120_P	0.720	0.99
92_V	129_T	0.717	0.99
164_I	211_V	0.715	0.99
162_D	175_F	0.713	0.99
16_R	19_V	0.711	0.99
50_D	54_R	0.708	0.99
152_D	155_V	0.708	0.99
66_W	72_Q	0.706	0.99
126_G	152_D	0.706	0.99
178_L	187_L	0.705	0.99
13_R	22_N	0.699	0.99
180_E	185_R	0.698	0.99
78_K	81_D	0.698	0.99
64_V	67_L	0.694	0.99
147_D	214_S	0.691	0.99
25_F	29_I	0.689	0.99
92_V	150_F	0.684	0.99
94_V	148_M	0.684	0.99
63_P	67_L	0.681	0.99
99_Q	104_K	0.675	0.99
65_G	71_H	0.675	0.99
62_L	68_D	0.667	0.99
103_W	174_T	0.667	0.99
158_C	161_D	0.665	0.99
21_G	25_F	0.663	0.99
137_D	145_P	0.662	0.99
114_S	118_T	0.662	0.99
181_D	198_Y	0.660	0.99
16_R	21_G	0.659	0.99
159_H	180_E	0.657	0.99
13_R	16_R	0.656	0.99
75_N	81_D	0.656	0.99
38_R	52_M	0.654	0.99
186_Y	195_P	0.650	0.99
143_Y	147_D	0.644	0.99
129_T	152_D	0.643	0.99
100_A	176_K	0.637	0.99
124_P	129_T	0.635	0.98
169_D	172_E	0.634	0.98
100_A	175_F	0.630	0.98
46_K	53_A	0.621	0.98
76_I	80_P	0.619	0.98
39_F	43_G	0.618	0.98
65_G	69_Q	0.616	0.98
21_G	40_M	0.612	0.98
44_A	52_M	0.611	0.98
119_Y	123_V	0.611	0.98
35_Q	52_M	0.610	0.98
149_I	164_I	0.607	0.98
44_A	68_D	0.606	0.98
132_L	173_T	0.605	0.98
77_T	81_D	0.604	0.98
53_A	57_E	0.603	0.98
117_E	123_V	0.598	0.98
26_A	34_T	0.593	0.98
29_I	56_I	0.591	0.98
119_Y	124_P	0.590	0.98
75_N	80_P	0.582	0.97
113_L	116_A	0.580	0.97
54_R	68_D	0.579	0.97
117_E	121_C	0.577	0.97
29_I	39_F	0.575	0.97
35_Q	50_D	0.570	0.97
57_E	63_P	0.569	0.97
168_H	172_E	0.567	0.97
150_F	215_G	0.565	0.97
38_R	42_D	0.565	0.97
38_R	41_G	0.565	0.97
116_A	122_P	0.564	0.97
183_T	201_I	0.561	0.97
15_L	25_F	0.558	0.97
165_A	207_I	0.557	0.97
53_A	68_D	0.557	0.97
46_K	56_I	0.556	0.97
37_S	40_M	0.555	0.96
65_G	70_E	0.554	0.96
41_G	47_N	0.552	0.96
23_S	26_A	0.551	0.96
76_I	79_K	0.550	0.96
99_Q	174_T	0.545	0.96
72_Q	76_I	0.544	0.96
95_I	130_Y	0.542	0.96
46_K	50_D	0.539	0.96
63_P	68_D	0.539	0.96
151_V	209_G	0.537	0.96
101_G	138_S	0.536	0.96
73_T	77_T	0.535	0.96
106_V	173_T	0.533	0.96
184_Q	201_I	0.532	0.96
99_Q	102_A	0.532	0.96
26_A	31_R	0.531	0.95
38_R	45_T	0.530	0.95
33_P	39_F	0.530	0.95
116_A	120_P	0.529	0.95
91_L	118_T	0.529	0.95
50_D	68_D	0.524	0.95
54_R	65_G	0.524	0.95
39_F	44_A	0.523	0.95
73_T	78_K	0.522	0.95
35_Q	44_A	0.522	0.95
55_H	59_C	0.518	0.95
39_F	69_Q	0.518	0.95
29_I	55_H	0.515	0.95
184_Q	203_G	0.514	0.95
74_T	78_K	0.514	0.95
143_Y	149_I	0.513	0.95
157_A	210_T	0.510	0.94
83_S	87_K	0.509	0.94
114_S	119_Y	0.509	0.94
80_P	87_K	0.508	0.94
34_T	46_K	0.505	0.94
114_S	122_P	0.505	0.94
12_A	36_T	0.504	0.94
15_L	66_W	0.502	0.94
30_D	55_H	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3bdnA	2	0.9598	100	0.284	Contact Map
1jhfA	2	0.8482	100	0.4	Contact Map
2fjrA	4	0.8304	100	0.403	Contact Map
3k2zA	2	0.8482	100	0.424	Contact Map
2hnfA	1	0.567	99.9	0.522	Contact Map
1umuA	2	0.4688	99.9	0.548	Contact Map
1kcaA	6	0.4241	99.8	0.603	Contact Map
2bnmA	3	0.8214	99.8	0.625	Contact Map
1dw9A	6	0.6205	99.5	0.701	Contact Map
4y42A	6	0.6161	99.3	0.721	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.