SUGE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SUGE - Quaternary ammonium compound-resistance protein SugE

UniProt:	P69937	Sequences: MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMKSLPVGTAYAVWTGIGAVGAAITGIVLLGESANPMRLASLALIVLGIIGLKLSTH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11616
Length:	105 (102)
Sequences:	4242 (2931)
Seq/√Len:	290.2

ECOLI - SUGE MDTJ MDTI EMRE
BACSU - YVDR YKKD YVAE EBRA YKKC EBRB YVDS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
89_S	99_G	2.859	1.00
12_L	41_V	2.647	1.00
48_W	51_K	2.548	1.00
5_I	48_W	2.439	1.00
75_I	82_A	2.347	1.00
19_G	34_I	2.332	1.00
15_V	38_A	2.141	1.00
2_S	52_S	2.141	1.00
71_A	90_L	1.955	1.00
73_T	77_L	1.931	1.00
10_G	65_I	1.929	1.00
50_M	58_A	1.808	1.00
92_L	96_G	1.808	1.00
30_T	34_I	1.736	1.00
53_L	58_A	1.728	1.00
16_W	38_A	1.577	1.00
91_A	95_L	1.520	1.00
36_V	40_I	1.519	1.00
15_V	34_I	1.498	1.00
23_T	32_S	1.489	1.00
92_L	95_L	1.485	1.00
39_M	43_M	1.473	1.00
44_A	48_W	1.465	1.00
18_V	22_Y	1.462	1.00
84_P	88_A	1.421	1.00
28_R	31_P	1.413	1.00
50_M	55_V	1.370	1.00
26_F	32_S	1.360	1.00
16_W	39_M	1.334	1.00
23_T	26_F	1.315	1.00
89_S	103_S	1.312	1.00
93_I	96_G	1.309	1.00
14_V	69_G	1.304	1.00
12_L	38_A	1.304	1.00
5_I	45_L	1.283	1.00
18_V	73_T	1.272	1.00
20_L	35_T	1.262	1.00
83_N	86_R	1.253	1.00
89_S	96_G	1.244	1.00
22_Y	78_L	1.234	1.00
29_L	32_S	1.233	1.00
98_I	102_L	1.205	1.00
87_L	91_A	1.191	1.00
49_A	58_A	1.174	1.00
90_L	100_L	1.153	1.00
85_M	103_S	1.148	1.00
67_A	71_A	1.139	1.00
30_T	33_V	1.133	1.00
3_W	61_V	1.119	1.00
46_L	58_A	1.110	1.00
81_S	86_R	1.106	1.00
15_V	19_G	1.096	1.00
89_S	93_I	1.087	1.00
24_H	28_R	1.083	1.00
29_L	33_V	1.036	1.00
86_R	100_L	1.030	1.00
82_A	87_L	1.029	1.00
7_V	65_I	1.022	1.00
40_I	44_A	0.983	1.00
85_M	88_A	0.981	1.00
4_I	8_I	0.964	1.00
82_A	86_R	0.950	1.00
57_T	86_R	0.936	1.00
61_V	65_I	0.919	1.00
93_I	97_I	0.908	1.00
8_I	45_L	0.904	1.00
95_L	99_G	0.894	1.00
72_I	76_V	0.892	1.00
2_S	53_L	0.887	1.00
68_V	90_L	0.880	1.00
68_V	94_V	0.869	1.00
21_K	25_G	0.866	1.00
19_G	22_Y	0.847	1.00
84_P	87_L	0.840	1.00
56_G	60_A	0.839	1.00
55_V	70_A	0.835	1.00
80_E	86_R	0.831	1.00
73_T	78_L	0.828	1.00
89_S	92_L	0.826	1.00
27_S	32_S	0.823	1.00
81_S	84_P	0.819	1.00
74_G	80_E	0.815	1.00
33_V	37_T	0.811	1.00
7_V	10_G	0.809	1.00
94_V	98_I	0.808	1.00
17_A	70_A	0.800	0.99
10_G	42_S	0.800	0.99
74_G	78_L	0.787	0.99
60_A	63_T	0.777	0.99
27_S	51_K	0.774	0.99
18_V	78_L	0.771	0.99
14_V	73_T	0.759	0.99
24_H	27_S	0.743	0.99
64_G	97_I	0.742	0.99
92_L	99_G	0.730	0.99
67_A	94_V	0.727	0.99
63_T	74_G	0.718	0.99
99_G	103_S	0.717	0.99
88_A	92_L	0.712	0.99
19_G	38_A	0.690	0.98
19_G	35_T	0.686	0.98
71_A	100_L	0.683	0.98
2_S	5_I	0.681	0.98
33_V	36_V	0.667	0.98
13_E	42_S	0.666	0.98
54_P	57_T	0.662	0.98
85_M	89_S	0.659	0.98
27_S	31_P	0.657	0.98
16_W	35_T	0.652	0.98
65_I	69_G	0.645	0.98
76_V	79_G	0.643	0.98
55_V	78_L	0.640	0.97
32_S	35_T	0.635	0.97
74_G	86_R	0.633	0.97
9_A	45_L	0.630	0.97
39_M	63_T	0.624	0.97
75_I	81_S	0.619	0.97
37_T	41_V	0.619	0.97
11_L	69_G	0.619	0.97
10_G	97_I	0.616	0.97
23_T	27_S	0.610	0.97
75_I	87_L	0.608	0.97
21_K	24_H	0.606	0.96
57_T	60_A	0.605	0.96
23_T	28_R	0.601	0.96
19_G	23_T	0.597	0.96
18_V	55_V	0.596	0.96
18_V	74_G	0.595	0.96
60_A	90_L	0.592	0.96
26_F	31_P	0.589	0.96
11_L	15_V	0.580	0.96
43_M	50_M	0.578	0.95
39_M	55_V	0.571	0.95
20_L	62_W	0.570	0.95
48_W	52_S	0.568	0.95
9_A	46_L	0.563	0.95
6_L	58_A	0.555	0.94
88_A	91_A	0.554	0.94
20_L	42_S	0.546	0.94
80_E	83_N	0.539	0.93
38_A	42_S	0.535	0.93
35_T	47_A	0.535	0.93
75_I	80_E	0.533	0.93
19_G	36_V	0.528	0.93
34_I	38_A	0.526	0.93
62_W	93_I	0.515	0.92
63_T	101_K	0.512	0.92
32_S	47_A	0.510	0.91
16_W	63_T	0.505	0.91
5_I	49_A	0.503	0.91
37_T	40_I	0.503	0.91
43_M	47_A	0.501	0.91
26_F	35_T	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3b5dA	2	0.9714	99.9	0.319	Contact Map
2i68A	2	0.7429	99.9	0.359	Contact Map
4pypA	1	1	6.2	0.931	Contact Map
1pw4A	1	1	3.7	0.938	Contact Map
4o9uB	2	0.6952	3.7	0.938	Contact Map
4gx0A	3	0.7524	2.7	0.942	Contact Map
3effK	4	0.7714	2.3	0.944	Contact Map
2gfpA	2	0.9905	2.3	0.944	Contact Map
2ls4A	1	0.2286	2.2	0.945	Contact Map
3rqwA	4	0.4762	2.2	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.