CUTA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CUTA - Divalent-cation tolerance protein CutA

UniProt:	P69488	Sequences: MLDEKSSNTASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12177
Length:	112 (102)
Sequences:	1692 (1312)
Seq/√Len:	129.9

ECOLI - CUTA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_E	79_C	2.517	1.00
23_T	85_P	2.431	1.00
99_G	104_L	2.402	1.00
32_L	49_L	2.307	1.00
73_Q	77_L	2.286	1.00
11_S	107_L	2.063	1.00
16_C	80_L	2.022	1.00
25_Q	58_Q	1.999	1.00
29_A	58_Q	1.887	1.00
79_C	83_H	1.809	1.00
40_A	66_L	1.772	1.00
30_K	79_C	1.750	1.00
81_K	102_D	1.712	1.00
31_V	66_L	1.681	1.00
72_H	75_A	1.661	1.00
19_P	85_P	1.618	1.00
37_A	66_L	1.613	1.00
69_T	72_H	1.561	1.00
20_D	23_T	1.554	1.00
21_E	25_Q	1.535	1.00
14_V	76_L	1.533	1.00
19_P	23_T	1.451	1.00
31_V	76_L	1.407	1.00
63_Q	90_E	1.397	1.00
25_Q	47_T	1.384	1.00
53_E	87_Q	1.369	1.00
12_V	93_V	1.352	1.00
43_I	63_Q	1.316	1.00
37_A	40_A	1.278	1.00
47_T	58_Q	1.272	1.00
42_L	49_L	1.269	1.00
73_Q	93_V	1.264	1.00
77_L	81_K	1.255	1.00
30_K	83_H	1.242	1.00
88_T	102_D	1.222	1.00
42_L	62_V	1.222	1.00
12_V	73_Q	1.217	1.00
27_L	83_H	1.203	0.99
16_C	66_L	1.200	0.99
105_S	109_A	1.194	0.99
35_K	51_Y	1.191	0.99
18_A	64_M	1.187	0.99
50_Y	59_E	1.148	0.99
41_T	46_A	1.132	0.99
41_T	63_Q	1.130	0.99
40_A	64_M	1.128	0.99
43_I	65_I	1.114	0.99
15_L	90_E	1.113	0.99
29_A	33_A	1.108	0.99
51_Y	56_L	1.086	0.99
11_S	108_N	1.080	0.99
31_V	37_A	1.077	0.99
30_K	34_E	1.067	0.99
15_L	94_L	1.058	0.99
90_E	103_Y	1.046	0.98
88_T	100_D	1.043	0.98
53_E	57_E	1.042	0.98
79_C	82_S	1.041	0.98
92_L	96_V	1.032	0.98
12_V	70_V	1.026	0.98
35_K	110_S	1.021	0.98
46_A	63_Q	1.020	0.98
11_S	99_G	1.015	0.98
51_Y	110_S	0.996	0.98
15_L	65_I	0.989	0.98
32_L	37_A	0.977	0.98
21_E	47_T	0.976	0.98
23_T	26_D	0.954	0.97
15_L	63_Q	0.946	0.97
78_E	82_S	0.940	0.97
81_K	100_D	0.937	0.97
69_T	111_L	0.932	0.97
96_V	99_G	0.924	0.97
18_A	62_V	0.918	0.97
28_A	40_A	0.909	0.96
31_V	79_C	0.889	0.96
74_Q	78_E	0.879	0.96
18_A	27_L	0.872	0.95
39_C	67_K	0.870	0.95
101_T	105_S	0.865	0.95
15_L	41_T	0.860	0.95
11_S	96_V	0.845	0.95
50_Y	57_E	0.845	0.95
73_Q	91_L	0.839	0.94
72_H	111_L	0.820	0.94
69_T	108_N	0.809	0.93
80_L	91_L	0.801	0.93
68_T	76_L	0.796	0.93
28_A	42_L	0.795	0.93
33_A	56_L	0.789	0.92
21_E	60_Y	0.788	0.92
25_Q	49_L	0.786	0.92
13_V	65_I	0.778	0.92
38_A	107_L	0.777	0.92
17_T	63_Q	0.777	0.92
77_L	91_L	0.773	0.91
32_L	51_Y	0.770	0.91
17_T	41_T	0.764	0.91
18_A	85_P	0.761	0.91
41_T	90_E	0.751	0.90
77_L	100_D	0.742	0.90
13_V	94_L	0.737	0.89
28_A	49_L	0.735	0.89
105_S	108_N	0.734	0.89
14_V	91_L	0.730	0.89
33_A	51_Y	0.730	0.89
27_L	79_C	0.729	0.89
103_Y	107_L	0.713	0.88
81_K	91_L	0.708	0.87
21_E	44_P	0.703	0.87
20_D	62_V	0.675	0.85
16_C	90_E	0.671	0.85
67_K	90_E	0.670	0.84
93_V	97_T	0.667	0.84
14_V	73_Q	0.658	0.83
25_Q	42_L	0.645	0.82
13_V	90_E	0.636	0.81
74_Q	77_L	0.634	0.81
11_S	104_L	0.633	0.81
88_T	107_L	0.629	0.81
77_L	98_H	0.628	0.80
72_H	76_L	0.624	0.80
34_E	82_S	0.624	0.80
93_V	98_H	0.613	0.79
36_L	79_C	0.610	0.79
41_T	65_I	0.596	0.77
43_I	46_A	0.595	0.77
77_L	93_V	0.594	0.77
99_G	107_L	0.585	0.76
26_D	30_K	0.583	0.75
74_Q	98_H	0.580	0.75
96_V	104_L	0.580	0.75
108_N	111_L	0.571	0.74
49_L	56_L	0.559	0.72
30_K	33_A	0.554	0.72
39_C	86_Y	0.553	0.71
49_L	58_Q	0.551	0.71
44_P	62_V	0.549	0.71
99_G	108_N	0.547	0.71
45_G	62_V	0.545	0.70
66_L	90_E	0.542	0.70
73_Q	100_D	0.539	0.70
75_A	78_E	0.536	0.69
66_L	80_L	0.534	0.69
25_Q	29_A	0.530	0.68
34_E	83_H	0.521	0.67
10_A	70_V	0.517	0.66
18_A	24_A	0.513	0.66
92_L	103_Y	0.512	0.66
45_G	60_Y	0.504	0.64
68_T	111_L	0.503	0.64
14_V	93_V	0.502	0.64
18_A	23_T	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zfhA	3	0.9643	100	0.069	Contact Map
4e98A	3	0.9821	100	0.07	Contact Map
4iyqA	3	0.9464	100	0.082	Contact Map
3gsdA	6	0.9375	100	0.082	Contact Map
1oscA	5	0.9643	100	0.087	Contact Map
1naqA	5	0.9464	100	0.094	Contact Map
1kr4A	3	0.9643	100	0.104	Contact Map
2zomA	3	0.9554	100	0.105	Contact Map
2nuhA	3	0.9286	100	0.105	Contact Map
3ahpA	3	0.9464	100	0.122	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.