TATA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TATA - Sec-independent protein translocase protein TatA

UniProt:	P69428	Sequences: MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11478
Length:	89 (74)
Sequences:	684 (570)
Seq/√Len:	66.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_Q	11_I	2.305	1.00
4_I	9_L	2.294	1.00
69_A	72_N	2.255	1.00
14_V	17_V	2.179	1.00
70_D	74_E	2.146	1.00
49_K	52_K	2.006	1.00
4_I	8_Q	1.994	1.00
1_M	13_A	1.907	1.00
71_T	74_E	1.806	1.00
3_G	9_L	1.643	0.99
70_D	73_Q	1.526	0.99
9_L	19_L	1.500	0.99
13_A	35_S	1.483	0.99
2_G	6_I	1.479	0.99
26_G	34_A	1.467	0.98
50_Q	53_T	1.465	0.98
36_I	42_A	1.430	0.98
41_K	44_S	1.404	0.98
46_D	49_K	1.402	0.98
56_D	59_F	1.400	0.98
67_K	70_D	1.399	0.98
2_G	7_W	1.387	0.98
23_K	30_S	1.379	0.98
30_S	35_S	1.350	0.97
1_M	9_L	1.336	0.97
67_K	71_T	1.320	0.97
65_A	68_Q	1.314	0.97
41_K	45_D	1.268	0.96
30_S	38_G	1.260	0.96
15_I	19_L	1.248	0.96
60_T	63_T	1.241	0.96
13_A	43_M	1.223	0.95
68_Q	74_E	1.216	0.95
17_V	24_K	1.185	0.94
12_I	15_I	1.173	0.94
28_I	35_S	1.097	0.92
19_L	42_A	1.096	0.92
59_F	62_K	1.070	0.91
18_L	28_I	1.056	0.90
24_K	36_I	1.038	0.89
7_W	11_I	1.028	0.89
17_V	22_T	1.022	0.88
1_M	8_Q	1.006	0.88
59_F	64_I	1.005	0.88
62_K	66_D	1.004	0.88
28_I	32_L	1.000	0.87
38_G	43_M	0.985	0.87
41_K	46_D	0.983	0.86
68_Q	71_T	0.946	0.84
12_I	19_L	0.924	0.83
45_D	48_P	0.905	0.81
8_Q	19_L	0.881	0.80
1_M	34_A	0.879	0.80
69_A	73_Q	0.865	0.78
28_I	38_G	0.856	0.78
2_G	12_I	0.845	0.77
15_I	45_D	0.838	0.76
16_V	24_K	0.817	0.74
9_L	15_I	0.813	0.74
52_K	56_D	0.807	0.73
24_K	35_S	0.806	0.73
64_I	67_K	0.804	0.73
23_K	26_G	0.799	0.73
2_G	9_L	0.793	0.72
26_G	30_S	0.787	0.72
9_L	42_A	0.783	0.71
51_D	54_S	0.772	0.70
17_V	34_A	0.765	0.69
29_G	38_G	0.758	0.69
23_K	36_I	0.748	0.68
50_Q	54_S	0.721	0.65
23_K	28_I	0.714	0.64
8_Q	42_A	0.708	0.63
61_A	64_I	0.705	0.63
4_I	19_L	0.703	0.63
16_V	36_I	0.702	0.63
4_I	15_I	0.702	0.63
14_V	18_L	0.698	0.62
37_K	45_D	0.695	0.62
55_Q	58_D	0.694	0.62
8_Q	15_I	0.687	0.61
51_D	55_Q	0.678	0.60
66_D	72_N	0.671	0.59
34_A	40_K	0.664	0.59
28_I	34_A	0.646	0.56
27_S	49_K	0.646	0.56
35_S	43_M	0.642	0.56
3_G	8_Q	0.632	0.55
32_L	38_G	0.631	0.55
12_I	40_K	0.617	0.53
13_A	24_K	0.614	0.53
52_K	55_Q	0.591	0.50
26_G	45_D	0.588	0.50
65_A	69_A	0.582	0.49
8_Q	16_V	0.569	0.47
18_L	22_T	0.569	0.47
23_K	27_S	0.567	0.47
24_K	34_A	0.557	0.46
65_A	70_D	0.556	0.46
17_V	44_S	0.555	0.46
5_S	32_L	0.546	0.45
58_D	62_K	0.544	0.44
18_L	42_A	0.534	0.43
63_T	66_D	0.529	0.43
14_V	32_L	0.528	0.43
26_G	29_G	0.527	0.42
8_Q	12_I	0.509	0.40
55_Q	60_T	0.509	0.40
66_D	70_D	0.503	0.40
13_A	23_K	0.503	0.40
5_S	36_I	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2mn6B	2	0.5169	99.7	0.464	Contact Map
2l16A	1	0.573	99.4	0.577	Contact Map
2lzrA	1	0.5506	99.3	0.607	Contact Map
2mi2A	1	1	99.3	0.607	Contact Map
4fu6A	1	0.5955	56.7	0.889	Contact Map
4cosA	1	0.9438	40.6	0.899	Contact Map
4rxjA	2	0.7416	40.3	0.899	Contact Map
1ri0A	1	0.6404	23.7	0.91	Contact Map
3qbyA	3	0.618	21.7	0.912	Contact Map
4n4gA	1	0.6966	20.8	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.