FIXX - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FIXX - Ferredoxin-like protein FixX

UniProt:	P68646	Sequences: MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPAGLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11565
Length:	95 (89)
Sequences:	361 (211)
Seq/√Len:	22.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_D	39_L	4.380	1.00
34_Q	39_L	4.324	1.00
85_R	88_F	3.694	1.00
26_V	80_Q	2.671	0.99
16_F	86_G	2.193	0.96
39_L	73_G	2.045	0.94
19_D	85_R	2.024	0.94
47_L	59_D	1.830	0.89
32_D	73_G	1.818	0.89
25_I	47_L	1.693	0.85
42_A	58_F	1.672	0.85
38_L	77_A	1.646	0.84
33_K	55_S	1.622	0.83
8_D	49_K	1.617	0.83
38_L	74_L	1.559	0.80
11_L	48_Y	1.540	0.79
23_P	83_Y	1.524	0.79
34_Q	73_G	1.514	0.78
16_F	47_L	1.508	0.78
46_G	49_K	1.465	0.76
23_P	58_F	1.465	0.76
28_K	31_A	1.386	0.71
42_A	72_L	1.385	0.71
47_L	62_G	1.349	0.69
16_F	93_R	1.341	0.69
37_E	50_K	1.337	0.69
47_L	58_F	1.312	0.67
25_I	62_G	1.309	0.67
7_V	35_A	1.247	0.63
39_L	72_L	1.240	0.63
10_K	62_G	1.192	0.60
26_V	78_L	1.189	0.59
20_E	61_A	1.174	0.58
51_Q	57_R	1.168	0.58
12_G	15_K	1.147	0.57
50_K	56_V	1.140	0.56
69_C	81_W	1.140	0.56
45_A	64_L	1.110	0.54
7_V	37_E	1.108	0.54
25_I	58_F	1.079	0.52
52_D	92_F	1.047	0.50
13_V	62_G	1.043	0.49
14_N	62_G	1.037	0.49
25_I	68_T	1.022	0.48
50_K	55_S	1.010	0.47
27_V	58_F	0.969	0.44
40_V	48_Y	0.963	0.44
13_V	61_A	0.962	0.44
12_G	58_F	0.954	0.43
19_D	48_Y	0.943	0.43
40_V	50_K	0.923	0.41
12_G	87_T	0.914	0.41
15_K	87_T	0.913	0.41
38_L	82_E	0.913	0.41
86_G	92_F	0.904	0.40
14_N	90_V	0.893	0.39
16_F	29_A	0.866	0.38
70_R	76_S	0.851	0.37
32_D	72_L	0.851	0.37
12_G	93_R	0.847	0.36
33_K	53_D	0.845	0.36
24_H	66_C	0.842	0.36
40_V	72_L	0.838	0.36
27_V	91_E	0.835	0.36
47_L	60_Y	0.832	0.35
14_N	64_L	0.830	0.35
9_V	42_A	0.822	0.35
30_D	51_Q	0.818	0.35
18_V	71_I	0.812	0.34
22_H	85_R	0.811	0.34
46_G	68_T	0.785	0.33
11_L	64_L	0.782	0.32
22_H	60_Y	0.779	0.32
7_V	19_D	0.777	0.32
42_A	47_L	0.762	0.31
17_N	49_K	0.753	0.31
49_K	82_E	0.752	0.31
47_L	68_T	0.746	0.30
6_N	9_V	0.744	0.30
56_V	91_E	0.737	0.30
84_P	89_G	0.732	0.29
30_D	33_K	0.730	0.29
10_K	16_F	0.714	0.28
68_T	81_W	0.709	0.28
5_V	50_K	0.706	0.28
12_G	90_V	0.698	0.28
36_L	39_L	0.687	0.27
49_K	68_T	0.684	0.27
12_G	25_I	0.679	0.26
27_V	78_L	0.676	0.26
36_L	74_L	0.668	0.26
50_K	54_G	0.651	0.25
23_P	47_L	0.646	0.25
28_K	52_D	0.642	0.25
7_V	42_A	0.639	0.24
47_L	61_A	0.635	0.24
74_L	77_A	0.634	0.24
56_V	94_Y	0.630	0.24
42_A	60_Y	0.619	0.23
48_Y	62_G	0.607	0.23
10_K	13_V	0.606	0.23
62_G	70_R	0.605	0.23
33_K	56_V	0.596	0.22
11_L	14_N	0.595	0.22
7_V	51_Q	0.592	0.22
35_A	77_A	0.590	0.22
50_K	53_D	0.584	0.22
40_V	93_R	0.584	0.22
10_K	86_G	0.583	0.22
5_V	28_K	0.574	0.21
36_L	76_S	0.572	0.21
16_F	46_G	0.572	0.21
45_A	54_G	0.566	0.21
31_A	52_D	0.564	0.21
40_V	88_F	0.563	0.21
10_K	95_G	0.555	0.20
35_A	92_F	0.554	0.20
51_Q	55_S	0.554	0.20
9_V	13_V	0.540	0.20
16_F	62_G	0.539	0.20
61_A	68_T	0.538	0.20
14_N	83_Y	0.533	0.19
34_Q	76_S	0.526	0.19
7_V	46_G	0.525	0.19
14_N	46_G	0.521	0.19
45_A	68_T	0.519	0.19
77_A	92_F	0.519	0.19
52_D	64_L	0.519	0.19
26_V	49_K	0.517	0.19
35_A	38_L	0.513	0.19
47_L	93_R	0.508	0.18
56_V	85_R	0.507	0.18
18_V	53_D	0.503	0.18
5_V	54_G	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gmhA	1	0.9789	99.5	0.626	Contact Map
1hfeL	2	0.9789	98.4	0.77	Contact Map
1q16B	2	0.9684	98.3	0.772	Contact Map
3mm5B	2	0.9579	98	0.789	Contact Map
2ivfB	1	0.9579	98	0.792	Contact Map
3gyxB	1	0.7474	98	0.793	Contact Map
1jnrB	1	0.7474	97.8	0.799	Contact Map
1xerA	2	0.8526	97.8	0.8	Contact Map
1jb0C	1	0.7158	97.7	0.804	Contact Map
7fd1A	1	0.7263	97.7	0.805	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.