HIGB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIGB - mRNA interferase HigB

UniProt:	P64578	Sequences: MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKCYIREVMTHKEYDFFTAVHRTKGKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12725
Length:	104 (93)
Sequences:	745 (563)
Seq/√Len:	58.3

ECOLI - HIGB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
63_G	66_E	3.963	1.00
20_K	24_V	2.864	1.00
2_H	79_K	2.728	1.00
62_V	69_V	2.612	1.00
58_Y	75_F	2.414	1.00
34_Y	78_Q	2.240	1.00
51_F	54_L	2.161	1.00
73_V	80_C	1.906	1.00
30_I	80_C	1.882	1.00
30_I	35_F	1.874	1.00
86_M	94_F	1.780	0.99
6_Q	27_G	1.766	0.99
29_T	45_F	1.730	0.99
12_A	85_V	1.678	0.99
37_K	40_S	1.634	0.99
13_A	24_V	1.618	0.99
57_H	94_F	1.582	0.99
5_T	8_A	1.574	0.98
12_A	67_L	1.549	0.98
36_K	78_Q	1.529	0.98
70_V	94_F	1.515	0.98
49_D	61_N	1.452	0.97
42_K	49_D	1.446	0.97
74_F	83_R	1.423	0.97
74_F	77_S	1.417	0.97
72_M	83_R	1.359	0.96
13_A	20_K	1.353	0.96
84_E	94_F	1.342	0.96
48_L	58_Y	1.334	0.96
3_L	27_G	1.324	0.96
57_H	86_M	1.315	0.95
7_K	11_D	1.285	0.95
74_F	81_Y	1.272	0.94
16_Y	85_V	1.266	0.94
23_L	62_V	1.222	0.93
48_L	61_N	1.180	0.92
25_A	29_T	1.178	0.92
26_L	60_F	1.175	0.92
10_K	14_E	1.166	0.91
10_K	13_A	1.165	0.91
3_L	31_A	1.149	0.91
2_H	81_Y	1.145	0.91
19_H	67_L	1.080	0.88
6_Q	24_V	1.051	0.86
30_I	41_L	1.030	0.85
29_T	44_V	1.009	0.84
57_H	83_R	1.005	0.84
38_P	75_F	0.988	0.83
57_H	84_E	0.980	0.82
23_L	85_V	0.979	0.82
22_E	64_G	0.976	0.82
9_L	85_V	0.965	0.81
37_K	41_L	0.952	0.80
38_P	50_N	0.951	0.80
15_K	36_K	0.949	0.80
21_T	24_V	0.932	0.79
61_N	69_V	0.919	0.78
42_K	47_S	0.915	0.78
72_M	81_Y	0.911	0.77
18_Q	67_L	0.901	0.77
3_L	30_I	0.894	0.76
12_A	16_Y	0.885	0.75
49_D	58_Y	0.882	0.75
42_K	61_N	0.874	0.74
18_Q	66_E	0.859	0.73
89_K	93_F	0.856	0.73
10_K	24_V	0.855	0.73
69_V	85_V	0.852	0.73
22_E	63_G	0.828	0.70
17_P	90_E	0.816	0.69
87_T	90_E	0.816	0.69
71_A	80_C	0.810	0.69
30_I	33_G	0.803	0.68
49_D	59_V	0.795	0.67
9_L	13_A	0.789	0.67
56_K	75_F	0.787	0.66
50_N	58_Y	0.781	0.66
70_V	86_M	0.780	0.66
19_H	66_E	0.773	0.65
72_M	77_S	0.766	0.64
41_L	73_V	0.761	0.64
3_L	21_T	0.744	0.62
2_H	78_Q	0.738	0.61
46_P	90_E	0.734	0.61
18_Q	61_N	0.727	0.60
4_I	74_F	0.721	0.60
3_L	82_I	0.716	0.59
2_H	83_R	0.709	0.58
51_F	59_V	0.708	0.58
39_E	93_F	0.696	0.57
5_T	83_R	0.695	0.57
9_L	67_L	0.694	0.57
12_A	87_T	0.677	0.55
79_K	83_R	0.672	0.54
33_G	44_V	0.670	0.54
47_S	61_N	0.667	0.54
59_V	81_Y	0.660	0.53
19_H	22_E	0.657	0.53
72_M	79_K	0.656	0.53
19_H	60_F	0.650	0.52
27_G	31_A	0.648	0.52
2_H	72_M	0.635	0.50
32_K	95_T	0.628	0.49
17_P	93_F	0.627	0.49
43_A	89_K	0.624	0.49
15_K	20_K	0.624	0.49
37_K	90_E	0.621	0.49
45_F	49_D	0.615	0.48
86_M	95_T	0.614	0.48
38_P	42_K	0.607	0.47
2_H	5_T	0.607	0.47
41_L	50_N	0.595	0.46
11_D	14_E	0.583	0.45
12_A	19_H	0.581	0.44
5_T	81_Y	0.579	0.44
6_Q	10_K	0.577	0.44
2_H	38_P	0.574	0.44
38_P	58_Y	0.573	0.43
42_K	64_G	0.564	0.42
36_K	40_S	0.558	0.42
6_Q	13_A	0.549	0.41
6_Q	39_E	0.548	0.41
28_N	76_E	0.542	0.40
55_D	77_S	0.538	0.40
43_A	46_P	0.538	0.40
16_Y	87_T	0.534	0.39
8_A	75_F	0.529	0.39
43_A	66_E	0.529	0.39
15_K	89_K	0.524	0.38
51_F	73_V	0.521	0.38
61_N	65_N	0.521	0.38
29_T	49_D	0.516	0.37
21_T	25_A	0.515	0.37
23_L	69_V	0.513	0.37
6_Q	72_M	0.513	0.37
28_N	77_S	0.510	0.37
46_P	49_D	0.505	0.36
74_F	78_Q	0.505	0.36
35_F	41_L	0.503	0.36
38_P	51_F	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3bpqB	1	0.7981	68.6	0.901	Contact Map
4nrnA	2	0.7885	62.3	0.905	Contact Map
3g5oB	1	0.7308	58.8	0.907	Contact Map
4lttA	1	0.7981	53.3	0.91	Contact Map
3oeiC	2	0.7404	42.4	0.915	Contact Map
1wmiA	2	0.7692	38.6	0.917	Contact Map
2kheA	1	0.7885	36.8	0.918	Contact Map
4ml2A	1	0.7692	35.6	0.919	Contact Map
2a6sA	1	0.7404	32.1	0.921	Contact Map
4mcxB	2	0.7596	25.6	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.