CPTB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CPTB - Antitoxin CptB

UniProt:	P64559	Sequences: MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13075
Length:	88 (77)
Sequences:	387 (229)
Seq/√Len:	26.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_C	43_F	4.603	1.00
6_K	33_D	4.081	1.00
39_E	71_M	2.870	1.00
27_F	35_L	2.835	1.00
37_D	40_K	2.687	0.99
66_D	69_L	2.589	0.99
45_R	66_D	2.230	0.98
39_E	75_L	2.185	0.97
10_H	29_E	2.013	0.96
52_P	61_H	1.865	0.93
63_K	74_R	1.629	0.88
42_I	68_E	1.598	0.87
72_M	75_L	1.541	0.84
58_L	77_Q	1.516	0.83
56_N	62_G	1.446	0.80
63_K	70_E	1.437	0.80
69_L	73_V	1.375	0.77
7_A	12_A	1.353	0.76
23_S	80_N	1.347	0.75
68_E	71_M	1.316	0.74
36_S	42_I	1.278	0.71
31_E	80_N	1.277	0.71
45_R	69_L	1.246	0.69
74_R	78_T	1.230	0.68
45_R	68_E	1.227	0.68
9_I	47_L	1.182	0.65
53_D	62_G	1.161	0.64
42_I	72_M	1.129	0.62
56_N	61_H	1.120	0.61
64_P	72_M	1.107	0.60
60_N	77_Q	1.107	0.60
32_Y	40_K	1.025	0.54
22_I	52_P	1.021	0.54
24_I	64_P	1.014	0.53
27_F	55_F	0.994	0.52
6_K	28_F	0.981	0.51
64_P	70_E	0.981	0.51
29_E	38_D	0.972	0.50
5_N	44_I	0.969	0.50
25_M	47_L	0.955	0.49
17_M	55_F	0.938	0.48
41_R	44_I	0.937	0.48
23_S	29_E	0.935	0.47
10_H	43_F	0.934	0.47
31_E	79_R	0.913	0.46
30_H	45_R	0.911	0.46
32_Y	44_I	0.908	0.45
64_P	73_V	0.906	0.45
26_P	40_K	0.879	0.43
18_R	22_I	0.877	0.43
70_E	74_R	0.873	0.43
9_I	44_I	0.865	0.42
46_L	69_L	0.840	0.41
22_I	30_H	0.839	0.40
12_A	28_F	0.837	0.40
18_R	35_L	0.794	0.37
52_P	56_N	0.784	0.37
36_S	39_E	0.777	0.36
9_I	28_F	0.773	0.36
28_F	80_N	0.762	0.35
44_I	47_L	0.758	0.35
18_R	27_F	0.752	0.34
8_R	67_A	0.746	0.34
7_A	29_E	0.745	0.34
23_S	30_H	0.738	0.33
9_I	77_Q	0.720	0.32
62_G	78_T	0.719	0.32
13_C	25_M	0.718	0.32
25_M	29_E	0.715	0.32
70_E	75_L	0.710	0.32
20_L	59_M	0.698	0.31
52_P	59_M	0.697	0.31
26_P	55_F	0.695	0.31
36_S	70_E	0.682	0.30
34_S	40_K	0.673	0.29
58_L	65_A	0.670	0.29
24_I	80_N	0.669	0.29
22_I	56_N	0.656	0.28
34_S	65_A	0.653	0.28
17_M	20_L	0.651	0.28
63_K	68_E	0.649	0.28
18_R	52_P	0.646	0.28
41_R	62_G	0.644	0.28
39_E	74_R	0.642	0.27
30_H	36_S	0.619	0.26
7_A	33_D	0.616	0.26
12_A	33_D	0.610	0.26
10_H	54_L	0.603	0.25
62_G	65_A	0.599	0.25
34_S	68_E	0.586	0.24
7_A	25_M	0.585	0.24
31_E	58_L	0.582	0.24
75_L	79_R	0.581	0.24
38_D	41_R	0.575	0.24
9_I	48_E	0.573	0.24
77_Q	80_N	0.564	0.23
9_I	71_M	0.553	0.23
45_R	72_M	0.547	0.22
18_R	21_D	0.547	0.22
38_D	48_E	0.542	0.22
36_S	72_M	0.537	0.22
48_E	67_A	0.530	0.21
11_W	16_G	0.527	0.21
11_W	15_R	0.527	0.21
11_W	14_R	0.527	0.21
24_I	60_N	0.526	0.21
18_R	56_N	0.522	0.21
7_A	13_C	0.519	0.21
34_S	41_R	0.519	0.21
10_H	13_C	0.518	0.21
36_S	49_C	0.517	0.21
39_E	42_I	0.517	0.21
6_K	44_I	0.507	0.20
48_E	64_P	0.506	0.20
17_M	21_D	0.503	0.20
22_I	58_L	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1x6iA	2	1	100	0.276	Contact Map
2jr5A	1	1	99.9	0.313	Contact Map
1puzA	1	0.8977	99.9	0.337	Contact Map
2lm4A	1	0.9886	99.9	0.366	Contact Map
1zzgA	2	0.7841	22	0.917	Contact Map
4gicA	2	0.5795	16.2	0.922	Contact Map
1kaeA	2	0.5795	13.9	0.924	Contact Map
2r2yA	1	0.8864	13.7	0.924	Contact Map
2kr0A	1	0.9886	12.8	0.925	Contact Map
4g09A	2	0.4886	10.2	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.