YEAK - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YEAK - Uncharacterized protein YeaK

UniProt:	P64483	Sequences: MTEMAKGSVTHQRLIALLSQEGADFRVVTHEAVGKCEAVSEIRGTALGQGAKALVCKVKGNGVNQHVLAILAADQQADLSQLASHIGGLRASLASPAEVDELTGCVFGAIPPFSFHPKLKLVADPLLFERFDEIAFNAGMLDKSVILKTADYLRIAQPELVNFRRTA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13497
Length:	167 (147)
Sequences:	5175 (3527)
Seq/√Len:	290.9

ECOLI - YEAK YBAK
BACSU - YJDI YWHH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
133_E	146_I	3.243	1.00
65_Q	120_K	2.710	1.00
151_D	154_R	2.609	1.00
86_I	122_V	2.442	1.00
19_S	25_F	2.406	1.00
57_K	98_E	2.393	1.00
99_V	110_I	2.306	1.00
148_K	151_D	2.242	1.00
153_L	160_L	2.226	1.00
81_Q	162_N	2.183	1.00
128_F	160_L	2.151	1.00
85_H	161_V	2.061	1.00
37_E	41_E	2.027	1.00
125_P	162_N	2.019	1.00
69_A	82_L	1.985	1.00
58_V	88_G	1.972	1.00
17_L	21_E	1.972	1.00
66_H	102_L	1.886	1.00
26_R	146_I	1.852	1.00
135_A	146_I	1.851	1.00
95_S	98_E	1.790	1.00
28_V	146_I	1.738	1.00
16_A	20_Q	1.672	1.00
21_E	155_I	1.665	1.00
49_Q	131_F	1.641	1.00
125_P	129_E	1.558	1.00
100_D	106_V	1.532	1.00
118_K	157_Q	1.530	1.00
56_C	82_L	1.529	1.00
96_P	107_F	1.497	1.00
55_V	119_L	1.473	1.00
48_G	131_F	1.433	1.00
78_D	81_Q	1.399	1.00
58_V	65_Q	1.392	1.00
67_V	82_L	1.392	1.00
115_F	121_L	1.350	1.00
46_A	49_Q	1.341	1.00
51_A	70_I	1.332	1.00
69_A	163_F	1.305	1.00
153_L	158_P	1.299	1.00
38_A	42_I	1.298	1.00
85_H	159_E	1.291	1.00
26_R	133_E	1.285	1.00
122_V	163_F	1.278	1.00
75_Q	126_L	1.268	1.00
16_A	19_S	1.266	1.00
51_A	127_L	1.241	1.00
56_C	77_A	1.239	1.00
150_A	153_L	1.239	1.00
48_G	74_D	1.236	1.00
128_F	150_A	1.210	1.00
125_P	128_F	1.206	1.00
98_E	101_E	1.200	1.00
27_V	143_K	1.190	1.00
58_V	91_A	1.189	1.00
98_E	102_L	1.177	1.00
57_K	92_S	1.171	1.00
15_I	27_V	1.164	1.00
15_I	19_S	1.157	1.00
12_Q	16_A	1.148	1.00
59_K	88_G	1.144	1.00
23_A	155_I	1.138	1.00
80_S	84_S	1.127	1.00
122_V	161_V	1.121	1.00
38_A	41_E	1.120	1.00
66_H	119_L	1.116	1.00
49_Q	146_I	1.109	1.00
56_C	67_V	1.096	1.00
68_L	115_F	1.075	1.00
60_G	88_G	1.068	1.00
49_Q	133_E	1.067	1.00
120_K	159_E	1.043	1.00
57_K	66_H	1.039	1.00
30_H	33_V	1.037	1.00
127_L	160_L	1.034	1.00
126_L	129_E	1.032	1.00
66_H	94_A	1.029	1.00
28_V	135_A	1.027	1.00
88_G	91_A	1.024	1.00
94_A	102_L	1.024	1.00
54_L	77_A	1.021	1.00
67_V	86_I	1.007	1.00
128_F	149_T	1.002	1.00
127_L	134_I	1.002	1.00
45_T	135_A	0.997	1.00
17_L	20_Q	0.987	1.00
71_L	77_A	0.981	1.00
18_L	145_V	0.978	1.00
32_A	35_K	0.974	1.00
99_V	107_F	0.974	1.00
124_D	162_N	0.964	1.00
132_D	148_K	0.962	1.00
150_A	154_R	0.956	1.00
54_L	93_L	0.951	1.00
138_A	144_S	0.940	1.00
31_E	42_I	0.938	1.00
43_R	135_A	0.927	1.00
32_A	38_A	0.926	1.00
81_Q	84_S	0.925	1.00
136_F	152_Y	0.923	1.00
21_E	154_R	0.922	1.00
29_T	143_K	0.915	1.00
67_V	88_G	0.915	1.00
57_K	60_G	0.913	1.00
58_V	67_V	0.909	1.00
102_L	119_L	0.907	1.00
112_P	152_Y	0.901	1.00
13_R	116_H	0.900	1.00
41_E	47_L	0.891	1.00
55_V	99_V	0.884	1.00
138_A	145_V	0.881	1.00
128_F	153_L	0.846	1.00
24_D	151_D	0.838	1.00
131_F	134_I	0.836	1.00
123_A	153_L	0.834	1.00
123_A	127_L	0.833	1.00
65_Q	88_G	0.831	1.00
147_L	151_D	0.829	1.00
136_F	147_L	0.829	1.00
41_E	44_G	0.813	1.00
32_A	36_C	0.813	1.00
106_V	141_L	0.802	0.99
18_L	25_F	0.800	0.99
37_E	47_L	0.796	0.99
100_D	107_F	0.790	0.99
59_K	89_L	0.790	0.99
70_I	121_L	0.785	0.99
97_A	100_D	0.783	0.99
13_R	16_A	0.775	0.99
33_V	38_A	0.771	0.99
92_S	95_S	0.767	0.99
71_L	163_F	0.763	0.99
122_V	159_E	0.755	0.99
19_S	24_D	0.748	0.99
140_M	143_K	0.736	0.99
45_T	50_G	0.736	0.99
51_A	134_I	0.719	0.99
67_V	91_A	0.711	0.99
55_V	110_I	0.711	0.99
34_G	38_A	0.708	0.99
43_R	144_S	0.708	0.99
123_A	160_L	0.701	0.99
105_C	111_P	0.700	0.99
71_L	75_Q	0.699	0.99
30_H	142_D	0.695	0.99
56_C	69_A	0.689	0.98
58_V	86_I	0.688	0.98
55_V	94_A	0.686	0.98
47_L	74_D	0.685	0.98
82_L	91_A	0.673	0.98
123_A	152_Y	0.669	0.98
113_F	156_A	0.667	0.98
56_C	91_A	0.662	0.98
96_P	100_D	0.648	0.98
53_A	68_L	0.647	0.98
30_H	43_R	0.645	0.98
23_A	151_D	0.645	0.98
68_L	119_L	0.644	0.98
82_L	86_I	0.642	0.98
102_L	117_P	0.641	0.98
24_D	148_K	0.640	0.97
66_H	98_E	0.638	0.97
137_N	144_S	0.638	0.97
33_V	42_I	0.636	0.97
40_S	73_A	0.636	0.97
18_L	23_A	0.636	0.97
39_V	144_S	0.634	0.97
150_A	160_L	0.630	0.97
113_F	152_Y	0.625	0.97
35_K	38_A	0.622	0.97
57_K	95_S	0.619	0.97
14_L	145_V	0.614	0.97
75_Q	124_D	0.614	0.97
51_A	126_L	0.611	0.97
96_P	99_V	0.608	0.97
50_G	73_A	0.603	0.96
37_E	74_D	0.602	0.96
82_L	122_V	0.600	0.96
81_Q	85_H	0.597	0.96
15_I	25_F	0.597	0.96
69_A	122_V	0.594	0.96
115_F	119_L	0.590	0.96
70_I	123_A	0.590	0.96
80_S	89_L	0.589	0.96
56_C	93_L	0.586	0.96
113_F	145_V	0.585	0.96
51_A	131_F	0.584	0.96
23_A	147_L	0.577	0.95
50_G	144_S	0.577	0.95
60_G	65_Q	0.577	0.95
123_A	158_P	0.573	0.95
77_A	163_F	0.570	0.95
46_A	131_F	0.566	0.95
103_T	116_H	0.565	0.95
30_H	144_S	0.564	0.95
58_V	89_L	0.563	0.95
32_A	142_D	0.560	0.95
39_V	50_G	0.554	0.94
33_V	36_C	0.547	0.94
135_A	144_S	0.543	0.94
129_E	162_N	0.537	0.93
105_C	114_S	0.533	0.93
23_A	26_R	0.532	0.93
112_P	136_F	0.532	0.93
45_T	146_I	0.529	0.93
25_F	145_V	0.529	0.93
40_S	43_R	0.526	0.93
70_I	136_F	0.526	0.93
25_F	151_D	0.526	0.93
36_C	40_S	0.521	0.92
104_G	116_H	0.520	0.92
56_C	79_L	0.513	0.92
149_T	160_L	0.512	0.92
29_T	140_M	0.508	0.91
14_L	111_P	0.507	0.91
132_D	150_A	0.506	0.91
49_Q	132_D	0.503	0.91
128_F	131_F	0.501	0.91
39_V	73_A	0.501	0.91
147_L	152_Y	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vjfA	1	0.9281	100	0.208	Contact Map
2z0xA	1	0.9281	100	0.21	Contact Map
1dbuA	1	0.8922	100	0.211	Contact Map
1vkiA	2	0.9341	100	0.216	Contact Map
3op6A	2	0.8982	100	0.219	Contact Map
2dxaA	1	0.9222	100	0.22	Contact Map
1wdvA	1	0.8922	100	0.226	Contact Map
3memA	1	0.8323	100	0.376	Contact Map
2j3lA	2	0.9701	97.9	0.803	Contact Map
2kpjA	1	0.5629	47.8	0.918	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.