YHBS - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YHBS - Uncharacterized N-acetyltransferase YhbS

UniProt:	P63417	Sequences: MLIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRFGFELAAHHDLRCRWPGTESAFQVHRLADDALNGVTGLVEYHEHFNRF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12788
Length:	167 (157)
Sequences:	2200 (1598)
Seq/√Len:	127.6

ECOLI - YHBS YJHQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_F	96_G	5.387	1.00
77_L	93_V	3.363	1.00
97_L	108_V	3.355	1.00
15_D	32_H	3.128	1.00
97_L	122_F	3.049	1.00
18_L	78_A	2.819	1.00
113_D	118_S	2.693	1.00
71_W	107_A	2.645	1.00
4_R	47_T	2.461	1.00
99_S	102_E	2.153	1.00
95_E	99_S	2.118	1.00
56_Y	78_A	2.097	1.00
17_L	53_V	2.072	1.00
20_R	80_D	2.015	1.00
64_V	156_G	1.994	1.00
81_E	84_R	1.987	1.00
6_E	43_G	1.973	1.00
83_Y	86_Q	1.936	1.00
106_A	147_A	1.927	1.00
90_R	119_R	1.923	1.00
48_D	83_Y	1.908	1.00
15_D	19_R	1.818	1.00
90_R	94_Y	1.782	1.00
6_E	35_R	1.740	1.00
44_L	95_E	1.723	1.00
72_V	105_Y	1.687	1.00
4_R	10_D	1.684	1.00
47_T	51_G	1.683	1.00
95_E	98_D	1.682	1.00
57_V	96_G	1.606	1.00
145_R	149_D	1.597	1.00
74_M	93_V	1.578	1.00
54_I	88_L	1.566	1.00
45_V	53_V	1.511	1.00
18_L	56_Y	1.494	1.00
90_R	120_F	1.429	1.00
44_L	96_G	1.402	1.00
114_P	140_A	1.400	1.00
79_V	88_L	1.394	1.00
25_D	28_A	1.390	1.00
73_G	160_Y	1.386	1.00
111_L	160_Y	1.383	1.00
131_R	157_L	1.363	1.00
5_V	99_S	1.357	1.00
72_V	100_L	1.325	1.00
118_S	142_Q	1.308	1.00
80_D	83_Y	1.307	1.00
126_A	138_E	1.302	1.00
74_M	110_T	1.286	1.00
40_L	58_A	1.284	1.00
109_V	130_L	1.282	1.00
52_Q	80_D	1.267	1.00
39_F	161_H	1.236	1.00
123_E	127_H	1.230	1.00
62_V	158_V	1.212	0.99
46_A	88_L	1.191	0.99
3_I	44_L	1.188	0.99
55_G	92_L	1.147	0.99
97_L	144_H	1.146	0.99
48_D	54_I	1.145	0.99
16_A	19_R	1.143	0.99
57_V	92_L	1.140	0.99
74_M	108_V	1.136	0.99
19_R	28_A	1.123	0.99
25_D	29_K	1.111	0.99
101_N	144_H	1.075	0.99
125_A	143_V	1.062	0.99
18_L	31_V	1.057	0.99
37_D	161_H	1.054	0.98
111_L	141_F	1.053	0.98
98_D	101_N	1.052	0.98
99_S	103_F	1.048	0.98
145_R	148_D	1.041	0.98
44_L	99_S	1.040	0.98
12_P	16_A	1.033	0.98
10_D	47_T	1.032	0.98
15_D	29_K	1.020	0.98
89_A	116_L	1.017	0.98
34_L	60_S	1.015	0.98
94_Y	98_D	0.994	0.98
113_D	142_Q	0.990	0.98
93_V	120_F	0.978	0.98
141_F	160_Y	0.956	0.97
24_S	28_A	0.954	0.97
57_V	77_L	0.948	0.97
91_Q	94_Y	0.932	0.97
73_G	141_F	0.932	0.97
113_D	140_A	0.923	0.96
62_V	71_W	0.916	0.96
15_D	28_A	0.914	0.96
14_I	40_L	0.911	0.96
54_I	83_Y	0.902	0.96
64_V	154_V	0.898	0.96
46_A	79_V	0.885	0.96
145_R	150_A	0.883	0.95
64_V	71_W	0.867	0.95
62_V	73_G	0.863	0.95
59_F	74_M	0.857	0.95
30_L	75_A	0.848	0.94
128_H	143_V	0.844	0.94
120_F	144_H	0.840	0.94
123_E	128_H	0.838	0.94
73_G	109_V	0.836	0.94
63_D	68_D	0.835	0.94
110_T	142_Q	0.835	0.94
65_Q	157_L	0.833	0.94
100_L	130_L	0.833	0.94
61_P	70_Q	0.821	0.93
37_D	40_L	0.821	0.93
61_P	105_Y	0.818	0.93
149_D	152_N	0.817	0.93
98_D	102_E	0.816	0.93
44_L	92_L	0.810	0.93
19_R	25_D	0.802	0.93
20_R	81_E	0.800	0.92
4_R	45_V	0.798	0.92
30_L	132_C	0.797	0.92
79_V	116_L	0.796	0.92
52_Q	83_Y	0.795	0.92
19_R	23_E	0.788	0.92
27_E	31_V	0.783	0.92
118_S	124_L	0.778	0.91
42_L	103_F	0.778	0.91
48_D	52_Q	0.775	0.91
71_W	109_V	0.775	0.91
20_R	82_K	0.772	0.91
13_G	52_Q	0.768	0.91
85_G	116_L	0.766	0.91
76_P	117_Y	0.764	0.91
16_A	20_R	0.762	0.90
65_Q	68_D	0.760	0.90
123_E	145_R	0.760	0.90
55_G	79_V	0.758	0.90
21_S	81_E	0.751	0.90
17_L	80_D	0.750	0.90
116_L	120_F	0.749	0.90
58_A	75_A	0.744	0.89
101_N	147_A	0.743	0.89
72_V	108_V	0.736	0.89
75_A	134_W	0.734	0.89
52_Q	82_K	0.728	0.88
111_L	136_G	0.726	0.88
125_A	129_D	0.726	0.88
27_E	30_L	0.725	0.88
77_L	92_L	0.724	0.88
42_L	100_L	0.719	0.88
23_E	26_A	0.714	0.87
57_V	93_V	0.712	0.87
41_T	61_P	0.709	0.87
5_V	44_L	0.705	0.87
114_P	118_S	0.701	0.86
106_A	150_A	0.701	0.86
59_F	100_L	0.685	0.85
44_L	55_G	0.684	0.85
29_K	33_D	0.675	0.84
66_G	115_A	0.669	0.84
116_L	119_R	0.664	0.83
94_Y	144_H	0.660	0.83
22_F	76_P	0.660	0.83
141_F	158_V	0.659	0.83
73_G	117_Y	0.657	0.83
18_L	43_G	0.656	0.83
11_A	35_R	0.636	0.81
65_Q	159_E	0.633	0.80
110_T	141_F	0.629	0.80
69_L	106_A	0.624	0.79
108_V	122_F	0.624	0.79
100_L	108_V	0.620	0.79
94_Y	120_F	0.617	0.79
138_E	142_Q	0.614	0.78
127_H	131_R	0.608	0.78
22_F	84_R	0.607	0.78
130_L	158_V	0.606	0.77
107_A	143_V	0.603	0.77
63_D	159_E	0.602	0.77
59_F	110_T	0.600	0.77
94_Y	101_N	0.596	0.76
84_R	117_Y	0.596	0.76
113_D	117_Y	0.593	0.76
64_V	107_A	0.592	0.76
48_D	86_Q	0.591	0.76
4_R	53_V	0.591	0.76
112_G	117_Y	0.590	0.76
43_G	56_Y	0.585	0.75
59_F	108_V	0.584	0.75
132_C	141_F	0.578	0.74
87_G	91_Q	0.577	0.74
77_L	89_A	0.575	0.74
23_E	28_A	0.574	0.74
18_L	25_D	0.570	0.73
132_C	157_L	0.569	0.73
150_A	154_V	0.569	0.73
101_N	146_L	0.568	0.73
13_G	53_V	0.565	0.72
17_L	21_S	0.564	0.72
26_A	29_K	0.562	0.72
19_R	26_A	0.562	0.72
136_G	139_S	0.562	0.72
69_L	154_V	0.561	0.72
73_G	134_W	0.558	0.71
76_P	112_G	0.558	0.71
109_V	158_V	0.556	0.71
47_T	53_V	0.552	0.71
66_G	159_E	0.549	0.70
30_L	60_S	0.547	0.70
11_A	40_L	0.545	0.70
60_S	140_A	0.542	0.69
22_F	30_L	0.538	0.69
113_D	116_L	0.536	0.68
11_A	14_I	0.535	0.68
46_A	55_G	0.533	0.68
27_E	111_L	0.530	0.68
111_L	158_V	0.528	0.67
90_R	116_L	0.527	0.67
12_P	15_D	0.521	0.66
110_T	144_H	0.520	0.66
34_L	40_L	0.517	0.66
42_L	105_Y	0.516	0.66
111_L	142_Q	0.516	0.66
118_S	140_A	0.515	0.65
41_T	100_L	0.513	0.65
57_V	110_T	0.513	0.65
124_L	138_E	0.512	0.65
7_I	10_D	0.512	0.65
12_P	47_T	0.511	0.65
75_A	110_T	0.508	0.64
19_R	24_S	0.508	0.64
31_V	58_A	0.507	0.64
13_G	16_A	0.506	0.64
6_E	109_V	0.505	0.64
72_V	103_F	0.504	0.64
75_A	111_L	0.503	0.64
14_I	31_V	0.502	0.63
38_G	61_P	0.501	0.63
55_G	88_L	0.500	0.63
48_D	51_G	0.500	0.63

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4zbgA	1	0.8743	99.9	0.535	Contact Map
4rs2A	1	1	99.9	0.565	Contact Map
1cjwA	1	0.8443	99.7	0.659	Contact Map
3te4A	1	0.8743	99.7	0.66	Contact Map
3sxnA	4	0.994	99.7	0.665	Contact Map
1kuxA	1	0.8443	99.7	0.666	Contact Map
2hv2A	4	0.994	99.7	0.667	Contact Map
1n71A	4	0.8683	99.7	0.668	Contact Map
3n7zA	4	0.994	99.7	0.67	Contact Map
3r1kA	4	0.994	99.7	0.671	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.