CBPM - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CBPM - Chaperone modulatory protein CbpM

UniProt:	P63264	Sequences: MANVTVTFTITEFCLHTGISEEELNEIVGLGVVEPREIQETTWVFDDHAAIVVQRAVRLRHELALDWPGIAVALTLMDDIAHLKQENRLLRQRLSRFVAHP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12194
Length:	101 (90)
Sequences:	235 (186)
Seq/√Len:	19.6

ECOLI - CBPM

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_A	70_I	3.617	1.00
46_D	49_A	3.365	1.00
13_F	53_V	2.346	0.96
23_E	27_I	2.309	0.95
86_E	91_R	2.283	0.95
14_C	24_L	2.217	0.94
27_I	32_V	2.200	0.94
37_E	40_E	2.134	0.93
32_V	67_W	2.106	0.92
79_D	84_K	1.934	0.89
56_A	75_T	1.823	0.86
13_F	50_A	1.810	0.85
5_T	85_Q	1.792	0.85
67_W	87_N	1.785	0.84
9_T	32_V	1.766	0.84
66_D	69_G	1.732	0.82
66_D	87_N	1.665	0.80
69_G	73_A	1.586	0.76
33_V	53_V	1.537	0.74
80_I	84_K	1.510	0.73
35_P	43_W	1.485	0.71
55_R	65_L	1.459	0.70
31_G	69_G	1.436	0.69
54_Q	68_P	1.412	0.67
4_V	66_D	1.383	0.66
29_G	72_V	1.353	0.64
41_T	84_K	1.345	0.64
7_T	68_P	1.314	0.62
27_I	67_W	1.308	0.61
10_I	52_V	1.299	0.61
77_M	90_L	1.291	0.60
27_I	60_R	1.258	0.58
11_T	21_E	1.218	0.56
37_E	44_V	1.211	0.55
35_P	45_F	1.172	0.53
52_V	66_D	1.148	0.51
70_I	75_T	1.133	0.50
31_G	63_L	1.120	0.49
9_T	12_E	1.086	0.47
62_E	75_T	1.084	0.47
50_A	74_L	1.082	0.47
50_A	80_I	1.056	0.45
4_V	67_W	1.048	0.45
14_C	56_A	1.047	0.45
17_T	87_N	1.042	0.44
8_F	38_I	1.025	0.43
3_N	50_A	1.002	0.42
18_G	80_I	0.996	0.42
27_I	52_V	0.988	0.41
12_E	51_I	0.965	0.40
42_T	70_I	0.959	0.39
33_V	50_A	0.950	0.39
33_V	73_A	0.909	0.36
32_V	87_N	0.904	0.36
28_V	43_W	0.900	0.36
39_Q	42_T	0.900	0.36
3_N	20_S	0.891	0.35
25_N	81_A	0.866	0.34
26_E	64_A	0.865	0.34
73_A	84_K	0.854	0.33
7_T	32_V	0.854	0.33
63_L	73_A	0.849	0.33
60_R	92_Q	0.834	0.32
62_E	66_D	0.827	0.32
48_H	78_D	0.806	0.30
52_V	79_D	0.804	0.30
71_A	77_M	0.803	0.30
28_V	39_Q	0.801	0.30
8_F	34_E	0.796	0.30
17_T	27_I	0.795	0.30
8_F	57_V	0.783	0.29
11_T	29_G	0.781	0.29
19_I	83_L	0.777	0.29
15_L	87_N	0.775	0.29
22_E	34_E	0.755	0.28
64_A	87_N	0.754	0.28
49_A	82_H	0.741	0.27
28_V	71_A	0.735	0.27
56_A	77_M	0.726	0.26
74_L	78_D	0.726	0.26
8_F	69_G	0.697	0.25
61_H	77_M	0.697	0.25
55_R	82_H	0.695	0.25
37_E	72_V	0.694	0.25
50_A	57_V	0.693	0.25
13_F	47_D	0.692	0.25
3_N	41_T	0.690	0.25
31_G	59_L	0.684	0.24
22_E	53_V	0.680	0.24
35_P	53_V	0.678	0.24
49_A	62_E	0.678	0.24
12_E	46_D	0.674	0.24
28_V	78_D	0.669	0.24
30_L	34_E	0.665	0.23
44_V	83_L	0.654	0.23
9_T	20_S	0.654	0.23
23_E	70_I	0.641	0.22
68_P	81_A	0.633	0.22
69_G	74_L	0.622	0.21
8_F	54_Q	0.621	0.21
17_T	68_P	0.621	0.21
28_V	47_D	0.619	0.21
16_H	53_V	0.618	0.21
40_E	51_I	0.617	0.21
37_E	43_W	0.604	0.21
74_L	79_D	0.603	0.21
66_D	91_R	0.593	0.20
62_E	65_L	0.591	0.20
40_E	73_A	0.590	0.20
48_H	89_L	0.589	0.20
60_R	78_D	0.587	0.20
20_S	73_A	0.580	0.20
31_G	73_A	0.579	0.20
17_T	65_L	0.574	0.19
68_P	73_A	0.571	0.19
6_V	39_Q	0.567	0.19
25_N	38_I	0.566	0.19
68_P	87_N	0.558	0.19
18_G	53_V	0.556	0.19
25_N	51_I	0.554	0.19
63_L	71_A	0.551	0.19
13_F	35_P	0.543	0.18
9_T	52_V	0.539	0.18
29_G	81_A	0.537	0.18
19_I	37_E	0.535	0.18
22_E	79_D	0.533	0.18
4_V	17_T	0.527	0.18
11_T	51_I	0.526	0.18
7_T	15_L	0.524	0.17
9_T	23_E	0.512	0.17
32_V	53_V	0.507	0.17
23_E	77_M	0.506	0.17
9_T	57_V	0.504	0.17
48_H	82_H	0.500	0.17
12_E	82_H	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ucsA	2	0.9901	99.4	0.635	Contact Map
4r24B	2	0.8317	98.3	0.763	Contact Map
4ua1A	2	0.8812	98	0.781	Contact Map
1r8dA	2	0.9406	97.9	0.783	Contact Map
2vz4A	2	0.8812	97.8	0.788	Contact Map
4r4eB	2	0.7921	97.8	0.788	Contact Map
3gpvA	2	0.9208	97.6	0.798	Contact Map
1q06A	2	0.9208	97.5	0.803	Contact Map
2jmlA	1	0.7822	97.4	0.804	Contact Map
2zhgA	2	0.9208	97.4	0.805	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.