GMHBB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GMHBB - D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase

UniProt:	P63228	Sequences: MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKKQQKPAQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11736
Length:	191 (166)
Sequences:	2584 (1802)
Seq/√Len:	139.9

ECOLI - GMHBB HIS7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
94_H	107_C	3.415	1.00
18_V	30_E	2.806	1.00
90_Y	123_Y	2.694	1.00
59_A	95_H	2.513	1.00
94_H	109_C	2.501	1.00
121_R	128_M	2.496	1.00
8_I	42_L	2.399	1.00
65_E	69_E	2.148	1.00
39_M	49_L	2.057	1.00
144_A	151_T	2.052	1.00
50_V	124_L	2.049	1.00
88_G	123_Y	2.043	1.00
88_G	124_L	1.966	1.00
31_F	78_S	1.888	1.00
90_Y	120_A	1.861	1.00
25_E	28_N	1.854	1.00
78_S	81_D	1.820	1.00
117_L	133_M	1.793	1.00
114_P	118_L	1.785	1.00
58_I	68_F	1.783	1.00
127_D	130_A	1.758	1.00
57_G	63_F	1.731	1.00
174_N	178_D	1.668	1.00
40_R	44_K	1.656	1.00
41_E	181_Q	1.646	1.00
64_T	67_Q	1.628	1.00
43_K	84_V	1.620	1.00
68_F	72_T	1.611	1.00
76_D	89_I	1.587	1.00
117_L	143_A	1.578	1.00
20_H	23_V	1.572	1.00
92_C	107_C	1.567	1.00
74_W	78_S	1.553	1.00
156_R	174_N	1.549	1.00
56_S	60_R	1.510	1.00
106_V	113_H	1.508	1.00
24_H	28_N	1.502	1.00
6_P	130_A	1.492	1.00
5_V	48_A	1.470	1.00
65_E	91_Y	1.445	1.00
43_K	49_L	1.439	1.00
126_I	131_S	1.421	1.00
79_L	84_V	1.404	1.00
20_H	30_E	1.403	1.00
16_I	39_M	1.399	1.00
92_C	109_C	1.392	1.00
113_H	146_A	1.374	1.00
17_N	29_F	1.366	1.00
50_V	120_A	1.339	1.00
48_A	87_D	1.329	1.00
175_S	178_D	1.324	1.00
134_V	179_L	1.318	1.00
51_V	89_I	1.275	1.00
43_K	85_D	1.269	1.00
133_M	143_A	1.240	1.00
39_M	43_K	1.239	1.00
173_L	182_A	1.237	1.00
75_M	89_I	1.225	1.00
31_F	36_I	1.221	1.00
51_V	86_L	1.217	1.00
41_E	45_M	1.210	1.00
114_P	146_A	1.208	1.00
119_S	123_Y	1.201	1.00
90_Y	119_S	1.200	1.00
26_I	71_L	1.193	1.00
138_L	142_Q	1.193	1.00
41_E	177_A	1.189	1.00
9_F	50_V	1.188	1.00
177_A	181_Q	1.185	1.00
173_L	179_L	1.184	1.00
9_F	131_S	1.180	1.00
9_F	52_V	1.159	0.99
38_A	180_P	1.158	0.99
29_F	75_M	1.142	0.99
142_Q	146_A	1.134	0.99
141_M	151_T	1.108	0.99
133_M	144_A	1.097	0.99
43_K	87_D	1.093	0.99
117_L	147_A	1.091	0.99
128_M	149_V	1.086	0.99
143_A	147_A	1.074	0.99
58_I	93_P	1.065	0.99
22_Y	56_S	1.063	0.99
35_V	38_A	1.062	0.99
19_D	159_K	1.056	0.99
52_V	133_M	1.053	0.99
108_D	113_H	1.046	0.99
26_I	74_W	1.039	0.99
43_K	79_L	1.029	0.99
145_V	170_D	1.029	0.99
67_Q	70_T	1.019	0.99
68_F	89_I	1.018	0.99
108_D	118_L	1.016	0.99
157_T	160_P	1.012	0.99
132_Y	153_V	1.007	0.98
133_M	149_V	1.004	0.98
49_L	86_L	0.997	0.98
73_E	77_W	0.996	0.98
39_M	79_L	0.994	0.98
42_L	49_L	0.993	0.98
74_W	77_W	0.987	0.98
17_N	23_V	0.986	0.98
6_P	47_F	0.983	0.98
95_H	105_Q	0.981	0.98
142_Q	145_V	0.977	0.98
7_A	48_A	0.976	0.98
19_D	56_S	0.968	0.98
128_M	131_S	0.942	0.98
50_V	88_G	0.935	0.98
153_V	179_L	0.933	0.98
114_P	143_A	0.931	0.97
15_T	139_E	0.914	0.97
80_A	85_D	0.902	0.97
36_I	82_R	0.892	0.97
36_I	79_L	0.891	0.97
90_Y	124_L	0.890	0.97
114_P	147_A	0.889	0.97
39_M	84_V	0.882	0.97
59_A	105_Q	0.874	0.96
56_S	62_K	0.873	0.96
40_R	82_R	0.872	0.96
34_G	37_D	0.862	0.96
107_C	113_H	0.849	0.96
97_Q	105_Q	0.821	0.95
18_V	32_I	0.815	0.95
41_E	44_K	0.814	0.95
24_H	56_S	0.808	0.94
72_T	75_M	0.807	0.94
52_V	120_A	0.806	0.94
77_W	80_A	0.806	0.94
151_T	170_D	0.806	0.94
6_P	48_A	0.803	0.94
49_L	84_V	0.799	0.94
132_Y	150_G	0.794	0.94
41_E	180_P	0.785	0.93
10_L	16_I	0.784	0.93
36_I	84_V	0.776	0.93
34_G	177_A	0.776	0.93
138_L	154_L	0.776	0.93
69_E	73_E	0.767	0.93
24_H	71_L	0.765	0.93
118_L	147_A	0.762	0.92
22_Y	57_G	0.760	0.92
20_H	28_N	0.751	0.92
156_R	160_P	0.751	0.92
32_I	35_V	0.748	0.92
143_A	146_A	0.747	0.92
16_I	51_V	0.744	0.91
19_D	23_V	0.741	0.91
56_S	95_H	0.737	0.91
22_Y	62_K	0.732	0.91
19_D	137_K	0.729	0.91
52_V	117_L	0.727	0.91
86_L	89_I	0.725	0.90
121_R	149_V	0.721	0.90
29_F	71_L	0.716	0.90
57_G	62_K	0.714	0.90
24_H	63_F	0.714	0.90
156_R	172_V	0.707	0.89
72_T	89_I	0.705	0.89
26_I	67_Q	0.703	0.89
150_G	171_W	0.702	0.89
18_V	33_D	0.700	0.89
50_V	90_Y	0.698	0.89
144_A	149_V	0.697	0.89
12_R	72_T	0.696	0.89
48_A	126_I	0.693	0.88
93_P	109_C	0.691	0.88
31_F	75_M	0.689	0.88
38_A	177_A	0.688	0.88
32_I	155_V	0.686	0.88
66_A	69_E	0.682	0.88
115_G	118_L	0.680	0.87
169_A	172_V	0.680	0.87
7_A	126_I	0.677	0.87
40_R	84_V	0.676	0.87
38_A	42_L	0.674	0.87
17_N	71_L	0.673	0.87
171_W	182_A	0.671	0.87
56_S	63_F	0.668	0.86
58_I	63_F	0.668	0.86
22_Y	60_R	0.666	0.86
118_L	121_R	0.666	0.86
42_L	180_P	0.664	0.86
118_L	122_D	0.663	0.86
78_S	82_R	0.661	0.86
117_L	128_M	0.660	0.86
26_I	70_T	0.660	0.86
71_L	75_M	0.658	0.86
63_F	71_L	0.657	0.86
9_F	126_I	0.643	0.84
71_L	74_W	0.642	0.84
133_M	141_M	0.642	0.84
37_D	82_R	0.639	0.84
136_D	140_D	0.636	0.84
9_F	120_A	0.631	0.83
173_L	178_D	0.628	0.83
138_L	169_A	0.625	0.83
8_I	153_V	0.615	0.82
15_T	141_M	0.612	0.81
17_N	21_G	0.611	0.81
90_Y	116_M	0.608	0.81
109_C	119_S	0.602	0.80
26_I	29_F	0.600	0.80
132_Y	151_T	0.597	0.80
79_L	82_R	0.597	0.80
17_N	75_M	0.596	0.80
16_I	31_F	0.593	0.79
68_F	71_L	0.592	0.79
67_Q	71_L	0.591	0.79
107_C	116_M	0.583	0.78
58_I	65_E	0.579	0.78
117_L	149_V	0.575	0.77
29_F	89_I	0.574	0.77
7_A	87_D	0.574	0.77
116_M	119_S	0.573	0.77
24_H	57_G	0.571	0.77
24_H	137_K	0.569	0.76
36_I	78_S	0.566	0.76
25_E	67_Q	0.561	0.75
53_T	89_I	0.559	0.75
63_F	68_F	0.558	0.75
57_G	110_R	0.557	0.75
35_V	42_L	0.555	0.75
94_H	116_M	0.554	0.74
24_H	68_F	0.549	0.74
79_L	86_L	0.546	0.73
35_V	176_L	0.545	0.73
156_R	161_I	0.542	0.73
158_G	172_V	0.541	0.73
48_A	124_L	0.540	0.73
23_V	71_L	0.537	0.72
153_V	173_L	0.537	0.72
21_G	60_R	0.534	0.72
178_D	181_Q	0.530	0.71
54_N	111_K	0.530	0.71
95_H	106_V	0.528	0.71
133_M	139_E	0.527	0.71
58_I	72_T	0.525	0.70
37_D	177_A	0.523	0.70
134_V	153_V	0.521	0.70
17_N	28_N	0.520	0.70
8_I	49_L	0.519	0.70
69_E	91_Y	0.519	0.70
50_V	123_Y	0.513	0.69
8_I	179_L	0.509	0.68
155_V	159_K	0.503	0.67
10_L	176_L	0.502	0.67
10_L	86_L	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3l8hA	1	0.9162	100	0.495	Contact Map
2gmwA	1	0.9581	100	0.532	Contact Map
4pnhA	4	0.7958	100	0.563	Contact Map
2fprA	2	0.8272	100	0.563	Contact Map
2o2xA	1	0.9791	100	0.572	Contact Map
3zvlA	1	0.9162	99.9	0.625	Contact Map
2ho4A	1	0.9058	99.9	0.636	Contact Map
3ib6A	4	0.8639	99.9	0.652	Contact Map
2odaA	2	0.8325	99.9	0.664	Contact Map
2ymmA	2	0.8377	99.9	0.679	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.