PLSY - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PLSY - Probable glycerol-3-phosphate acyltransferase

UniProt:	P60782	Sequences: MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLIFDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGWDLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDNIQRLWRRQETKIWTKFKRKREKDPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11674
Length:	205 (189)
Sequences:	3193 (2343)
Seq/√Len:	170.4

ECOLI - PLSY
BACSU - PLSY

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_S	61_F	4.146	1.00
21_A	41_P	3.475	1.00
9_I	89_A	3.301	1.00
145_I	174_L	3.111	1.00
87_A	114_A	2.867	1.00
67_M	117_P	2.723	1.00
133_T	146_V	2.639	1.00
182_Q	186_R	2.426	1.00
66_G	110_T	2.347	1.00
134_V	143_G	2.319	1.00
19_S	100_F	2.287	1.00
47_L	55_A	2.264	1.00
13_Y	98_V	2.234	1.00
92_L	96_W	2.143	1.00
175_L	178_H	2.137	1.00
139_Y	184_L	2.136	1.00
129_T	154_Y	2.102	1.00
17_S	99_F	2.024	1.00
15_C	69_P	1.911	1.00
95_I	107_G	1.903	1.00
108_V	173_I	1.864	1.00
36_S	49_I	1.806	1.00
91_C	111_A	1.773	1.00
32_D	35_T	1.756	1.00
8_M	86_I	1.755	1.00
24_V	54_A	1.702	1.00
59_L	63_V	1.697	1.00
134_V	192_I	1.686	1.00
19_S	41_P	1.646	1.00
43_A	109_A	1.621	1.00
97_P	100_F	1.605	1.00
31_P	36_S	1.576	1.00
64_L	67_M	1.553	1.00
23_L	27_L	1.532	1.00
155_V	166_V	1.527	1.00
182_Q	185_W	1.526	1.00
149_L	174_L	1.514	1.00
22_I	100_F	1.513	1.00
95_I	176_R	1.448	1.00
91_C	169_L	1.438	1.00
179_D	183_R	1.425	1.00
137_S	143_G	1.416	1.00
140_S	144_A	1.412	1.00
178_H	182_Q	1.408	1.00
43_A	59_L	1.408	1.00
67_M	71_W	1.404	1.00
152_P	167_S	1.382	1.00
28_C	54_A	1.378	1.00
91_C	95_I	1.373	1.00
152_P	170_S	1.353	1.00
12_A	86_I	1.334	1.00
95_I	173_I	1.322	1.00
129_T	150_I	1.318	1.00
112_F	123_T	1.313	1.00
69_P	86_I	1.310	1.00
22_I	41_P	1.304	1.00
163_T	167_S	1.304	1.00
156_W	163_T	1.304	1.00
125_V	154_Y	1.300	1.00
24_V	61_F	1.288	1.00
9_I	85_L	1.285	1.00
145_I	181_I	1.280	1.00
12_A	89_A	1.270	1.00
133_T	143_G	1.259	1.00
44_T	140_S	1.247	1.00
25_C	46_V	1.241	1.00
73_A	82_W	1.216	1.00
138_G	193_W	1.215	1.00
179_D	182_Q	1.215	1.00
124_G	128_G	1.213	1.00
148_A	173_I	1.205	1.00
130_W	140_S	1.199	1.00
46_V	50_G	1.197	1.00
133_T	137_S	1.194	1.00
13_Y	97_P	1.186	1.00
111_A	173_I	1.181	1.00
41_P	100_F	1.170	1.00
8_M	12_A	1.169	1.00
25_C	50_G	1.152	1.00
151_A	166_V	1.145	1.00
111_A	169_L	1.142	1.00
141_S	184_L	1.140	1.00
138_G	191_K	1.109	1.00
137_S	142_L	1.107	1.00
17_S	98_V	1.105	1.00
70_V	117_P	1.101	1.00
80_P	83_L	1.099	1.00
18_I	23_L	1.096	1.00
133_T	142_L	1.093	1.00
14_L	17_S	1.088	1.00
142_L	146_V	1.088	1.00
46_V	58_V	1.074	1.00
73_A	86_I	1.073	1.00
109_A	113_G	1.072	1.00
139_Y	142_L	1.065	1.00
119_G	122_L	1.047	0.99
131_L	135_L	1.044	0.99
47_L	192_I	1.034	0.99
153_F	157_W	1.031	0.99
22_I	34_R	1.024	0.99
52_K	56_V	1.024	0.99
139_Y	191_K	1.021	0.99
24_V	57_A	1.014	0.99
122_L	155_V	1.014	0.99
135_L	138_G	1.013	0.99
119_G	155_V	0.997	0.99
130_W	143_G	0.996	0.99
38_S	48_R	0.984	0.99
22_I	25_C	0.984	0.99
112_F	147_S	0.979	0.99
33_P	46_V	0.975	0.99
95_I	172_L	0.972	0.99
50_G	58_V	0.971	0.99
57_A	61_F	0.964	0.99
66_G	114_A	0.958	0.99
66_G	113_G	0.955	0.99
9_I	82_W	0.949	0.99
170_S	174_L	0.944	0.99
182_Q	188_Q	0.940	0.99
108_V	144_A	0.939	0.99
21_A	58_V	0.935	0.99
44_T	48_R	0.928	0.99
88_I	168_M	0.925	0.99
51_G	54_A	0.924	0.99
183_R	189_E	0.918	0.99
150_I	154_Y	0.914	0.99
41_P	97_P	0.904	0.98
171_C	175_L	0.902	0.98
126_M	151_A	0.900	0.98
25_C	33_P	0.898	0.98
181_I	185_W	0.891	0.98
31_P	35_T	0.885	0.98
152_P	163_T	0.881	0.98
70_V	83_L	0.874	0.98
25_C	31_P	0.872	0.98
21_A	40_N	0.866	0.98
44_T	141_S	0.865	0.98
70_V	74_Y	0.863	0.98
5_A	82_W	0.857	0.98
139_Y	190_T	0.850	0.98
180_N	189_E	0.828	0.97
164_F	168_M	0.826	0.97
122_L	154_Y	0.820	0.97
64_L	68_L	0.816	0.97
39_G	49_I	0.811	0.97
50_G	54_A	0.799	0.97
71_W	75_E	0.791	0.96
24_V	29_G	0.781	0.96
58_V	61_F	0.781	0.96
152_P	156_W	0.775	0.96
44_T	180_N	0.769	0.96
33_P	41_P	0.767	0.96
19_S	22_I	0.764	0.96
84_G	165_P	0.757	0.95
69_P	90_A	0.755	0.95
60_I	64_L	0.752	0.95
133_T	150_I	0.746	0.95
144_A	177_H	0.744	0.95
26_R	32_D	0.741	0.95
152_P	166_V	0.738	0.95
183_R	188_Q	0.734	0.94
63_V	116_A	0.728	0.94
116_A	123_T	0.726	0.94
163_T	166_V	0.726	0.94
177_H	180_N	0.725	0.94
138_G	192_I	0.724	0.94
30_L	50_G	0.723	0.94
25_C	29_G	0.722	0.94
91_C	114_A	0.721	0.94
70_V	73_A	0.715	0.94
24_V	28_C	0.713	0.94
8_M	76_L	0.709	0.93
165_P	169_L	0.707	0.93
35_T	39_G	0.707	0.93
91_C	107_G	0.704	0.93
74_Y	83_L	0.702	0.93
22_I	33_P	0.700	0.93
78_V	82_W	0.697	0.93
59_L	109_A	0.692	0.93
175_L	179_D	0.689	0.92
48_R	141_S	0.688	0.92
121_D	124_G	0.685	0.92
34_R	97_P	0.684	0.92
130_W	147_S	0.682	0.92
111_A	147_S	0.680	0.92
31_P	50_G	0.674	0.92
71_W	74_Y	0.672	0.91
17_S	90_A	0.671	0.91
71_W	117_P	0.667	0.91
143_G	147_S	0.667	0.91
141_S	144_A	0.667	0.91
47_L	56_V	0.666	0.91
46_V	55_A	0.666	0.91
87_A	90_A	0.661	0.91
90_A	110_T	0.657	0.91
89_A	92_L	0.655	0.90
139_Y	143_G	0.654	0.90
6_P	10_L	0.653	0.90
132_L	136_L	0.649	0.90
74_Y	80_P	0.649	0.90
25_C	36_S	0.649	0.90
154_Y	158_F	0.647	0.90
155_V	163_T	0.646	0.90
53_G	57_A	0.644	0.90
145_I	149_L	0.643	0.90
96_W	176_R	0.640	0.89
106_K	177_H	0.638	0.89
5_A	9_I	0.636	0.89
69_P	73_A	0.634	0.89
38_S	44_T	0.627	0.88
15_C	68_L	0.626	0.88
115_I	166_V	0.619	0.88
83_L	118_I	0.619	0.88
44_T	144_A	0.618	0.88
41_P	107_G	0.616	0.88
79_S	83_L	0.612	0.87
95_I	111_A	0.610	0.87
48_R	180_N	0.607	0.87
25_C	49_I	0.603	0.86
111_A	148_A	0.599	0.86
85_L	89_A	0.597	0.86
141_S	183_R	0.597	0.86
59_L	112_F	0.596	0.86
40_N	106_K	0.592	0.85
156_W	167_S	0.590	0.85
96_W	172_L	0.589	0.85
167_S	171_C	0.585	0.85
24_V	27_L	0.585	0.85
14_L	99_F	0.584	0.85
164_F	171_C	0.579	0.84
73_A	83_L	0.579	0.84
66_G	70_V	0.576	0.84
183_R	190_T	0.575	0.84
134_V	140_S	0.573	0.84
156_W	161_Q	0.570	0.83
97_P	103_K	0.568	0.83
130_W	134_V	0.566	0.83
19_S	97_P	0.566	0.83
115_I	169_L	0.566	0.83
12_A	15_C	0.565	0.83
33_P	49_I	0.563	0.82
82_W	86_I	0.563	0.82
61_F	173_I	0.560	0.82
155_V	159_K	0.558	0.82
47_L	52_K	0.557	0.82
19_S	99_F	0.557	0.82
34_R	100_F	0.556	0.82
30_L	51_G	0.555	0.82
11_I	15_C	0.550	0.81
148_A	174_L	0.550	0.81
96_W	175_L	0.550	0.81
142_L	184_L	0.550	0.81
47_L	54_A	0.543	0.80
43_A	58_V	0.542	0.80
38_S	180_N	0.539	0.80
48_R	144_A	0.538	0.80
41_P	50_G	0.537	0.79
40_N	45_N	0.534	0.79
72_G	76_L	0.533	0.79
131_L	134_V	0.530	0.79
47_L	59_L	0.528	0.78
22_I	26_R	0.527	0.78
185_W	188_Q	0.525	0.78
125_V	129_T	0.524	0.78
88_I	169_L	0.524	0.78
74_Y	117_P	0.522	0.78
15_C	66_G	0.521	0.77
141_S	189_E	0.520	0.77
124_G	138_G	0.517	0.77
56_V	60_I	0.516	0.77
141_S	180_N	0.515	0.77
24_V	58_V	0.514	0.76
21_A	46_V	0.513	0.76
38_S	177_H	0.513	0.76
97_P	111_A	0.511	0.76
28_C	31_P	0.509	0.76
56_V	59_L	0.508	0.76
46_V	54_A	0.507	0.75
81_F	84_G	0.506	0.75
38_S	141_S	0.506	0.75
112_F	127_A	0.505	0.75
63_V	67_M	0.505	0.75
177_H	189_E	0.504	0.75
129_T	152_P	0.500	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ldsA	2	0.8439	39.6	0.943	Contact Map
1pw4A	1	0.7756	26.2	0.948	Contact Map
4pypA	1	0.6927	19.7	0.951	Contact Map
4m64A	1	0.7902	17.5	0.952	Contact Map
4ezcA	3	0.9268	14.2	0.954	Contact Map
2b6oA	6	0.7317	11	0.956	Contact Map
4zw9A	1	0.7415	8.8	0.958	Contact Map
3o7qA	1	0.8878	8.7	0.958	Contact Map
2l16A	1	0.2537	7.5	0.959	Contact Map
4j05A	3	0.6537	7.3	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.