LIPB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

LIPB - Octanoyltransferase

UniProt:	P60720	Sequences: MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYPVFTQGQAGKAEHILMPGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPFLRINPCGYAGMEMAKISQWKPEATTNNIAPRLLENILALLNNPDFEYITA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11591
Length:	213 (195)
Sequences:	2934 (1845)
Seq/√Len:	132.1

ECOLI - LIPB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
109_V	137_C	3.948	1.00
85_M	152_L	3.541	1.00
107_Q	111_N	3.427	1.00
115_E	198_N	3.037	1.00
14_Q	41_V	2.643	1.00
138_S	176_M	2.542	1.00
10_Q	192_A	2.461	1.00
30_R	36_D	2.409	1.00
111_N	201_A	2.400	1.00
14_Q	19_I	2.363	1.00
118_I	179_I	2.176	1.00
40_L	85_M	2.166	1.00
158_M	178_K	2.078	1.00
116_L	194_R	2.039	1.00
112_T	198_N	2.031	1.00
107_Q	122_P	2.028	1.00
101_L	141_L	2.015	1.00
17_E	21_Q	1.988	1.00
108_T	199_I	1.953	1.00
134_K	175_E	1.938	1.00
113_L	136_I	1.927	1.00
178_K	181_Q	1.834	1.00
57_H	74_Q	1.832	1.00
110_V	122_P	1.829	1.00
118_I	131_V	1.828	1.00
115_E	194_R	1.825	1.00
134_K	182_W	1.817	1.00
111_N	202_L	1.791	1.00
87_V	105_L	1.790	1.00
25_E	29_T	1.741	1.00
15_P	18_P	1.690	1.00
58_I	75_V	1.679	1.00
13_L	42_E	1.676	1.00
45_P	77_Y	1.673	1.00
24_H	70_D	1.673	1.00
47_F	165_R	1.644	1.00
27_T	149_F	1.637	1.00
13_L	44_Y	1.634	1.00
15_P	44_Y	1.618	1.00
152_L	195_L	1.611	1.00
15_P	65_P	1.559	1.00
157_N	180_S	1.555	1.00
154_L	191_I	1.541	1.00
64_I	162_P	1.510	1.00
115_E	197_E	1.500	1.00
55_A	68_Q	1.493	1.00
83_Q	195_L	1.482	1.00
114_A	119_E	1.441	1.00
187_T	190_N	1.431	1.00
100_E	104_L	1.424	1.00
20_S	24_H	1.414	1.00
111_N	198_N	1.412	1.00
17_E	67_I	1.384	1.00
154_L	179_I	1.383	1.00
177_A	182_W	1.345	1.00
96_L	146_G	1.344	1.00
199_I	203_L	1.341	1.00
21_Q	24_H	1.340	1.00
98_V	143_I	1.333	1.00
113_L	120_A	1.317	1.00
17_E	65_P	1.299	1.00
112_T	116_L	1.262	1.00
92_K	96_L	1.260	1.00
158_M	162_P	1.250	1.00
99_R	103_T	1.245	1.00
77_Y	158_M	1.241	1.00
143_I	148_S	1.237	1.00
26_F	34_T	1.235	1.00
11_L	39_W	1.232	1.00
26_F	39_W	1.227	1.00
112_T	194_R	1.226	1.00
167_N	171_Y	1.217	1.00
87_V	101_L	1.208	1.00
21_Q	25_E	1.204	0.99
30_R	88_L	1.188	0.99
30_R	34_T	1.178	0.99
161_S	164_L	1.174	0.99
97_G	100_E	1.172	0.99
110_V	120_A	1.165	0.99
19_I	44_Y	1.156	0.99
45_P	162_P	1.145	0.99
77_Y	162_P	1.135	0.99
156_V	188_T	1.124	0.99
138_S	174_M	1.124	0.99
179_I	191_I	1.118	0.99
36_D	94_R	1.101	0.99
45_P	80_P	1.100	0.99
180_S	185_E	1.098	0.99
51_Q	142_R	1.088	0.99
101_L	148_S	1.086	0.99
113_L	179_I	1.080	0.99
188_T	192_A	1.078	0.99
198_N	201_A	1.066	0.99
85_M	195_L	1.064	0.99
70_D	142_R	1.060	0.99
85_M	109_V	1.054	0.99
168_P	176_M	1.050	0.99
20_S	70_D	1.047	0.99
47_F	64_I	1.043	0.99
109_V	154_L	1.040	0.99
171_Y	174_M	1.040	0.99
194_R	198_N	1.036	0.98
107_Q	202_L	1.035	0.98
190_N	194_R	1.030	0.98
109_V	152_L	1.000	0.98
136_I	177_A	0.999	0.98
9_R	39_W	0.993	0.98
123_R	126_A	0.990	0.98
97_G	146_G	0.983	0.98
121_H	133_E	0.962	0.98
104_L	202_L	0.959	0.97
163_F	166_I	0.955	0.97
18_P	21_Q	0.944	0.97
42_E	189_N	0.944	0.97
26_F	37_E	0.928	0.97
177_A	181_Q	0.921	0.97
106_E	110_V	0.908	0.97
156_V	191_I	0.902	0.96
134_K	181_Q	0.901	0.96
49_Q	53_G	0.897	0.96
184_P	190_N	0.895	0.96
24_H	28_D	0.889	0.96
109_V	195_L	0.884	0.96
79_G	162_P	0.884	0.96
103_T	122_P	0.879	0.96
38_I	85_M	0.870	0.96
22_A	25_E	0.866	0.95
198_N	202_L	0.863	0.95
157_N	185_E	0.859	0.95
112_T	191_I	0.854	0.95
144_R	149_F	0.850	0.95
196_L	200_L	0.846	0.95
20_S	69_S	0.846	0.95
22_A	39_W	0.842	0.95
9_R	37_E	0.840	0.95
110_V	129_V	0.836	0.94
39_W	88_L	0.836	0.94
91_L	143_I	0.831	0.94
137_C	153_A	0.830	0.94
83_Q	188_T	0.830	0.94
28_D	31_D	0.821	0.94
156_V	180_S	0.814	0.94
89_L	148_S	0.813	0.94
91_L	148_S	0.805	0.93
105_L	152_L	0.800	0.93
64_I	77_Y	0.795	0.93
83_Q	192_A	0.792	0.93
137_C	152_L	0.789	0.93
23_M	39_W	0.786	0.92
42_E	192_A	0.782	0.92
99_R	102_V	0.775	0.92
194_R	197_E	0.770	0.92
189_N	193_P	0.769	0.92
95_K	100_E	0.767	0.92
89_L	101_L	0.761	0.91
10_Q	193_P	0.760	0.91
159_D	162_P	0.759	0.91
187_T	193_P	0.758	0.91
193_P	197_E	0.758	0.91
163_F	168_P	0.757	0.91
97_G	103_T	0.752	0.91
159_D	178_K	0.749	0.91
122_P	125_D	0.749	0.91
62_G	165_R	0.749	0.91
32_D	90_N	0.743	0.90
36_D	93_R	0.741	0.90
98_V	102_V	0.739	0.90
142_R	149_F	0.738	0.90
27_T	147_C	0.737	0.90
195_L	199_I	0.732	0.90
29_T	33_S	0.721	0.89
54_K	74_Q	0.721	0.89
137_C	154_L	0.718	0.89
66_V	75_V	0.718	0.89
26_F	30_R	0.717	0.89
102_V	139_L	0.716	0.88
172_A	175_E	0.716	0.88
106_E	122_P	0.714	0.88
60_M	165_R	0.713	0.88
138_S	163_F	0.709	0.88
61_P	165_R	0.708	0.88
46_V	67_I	0.706	0.88
89_L	94_R	0.704	0.88
60_M	63_D	0.702	0.87
43_H	86_Y	0.701	0.87
161_S	165_R	0.695	0.87
27_T	30_R	0.693	0.87
11_L	14_Q	0.690	0.87
123_R	174_M	0.688	0.86
103_T	107_Q	0.686	0.86
123_R	133_E	0.683	0.86
171_Y	175_E	0.681	0.86
138_S	175_E	0.681	0.86
59_L	167_N	0.675	0.85
79_G	158_M	0.675	0.85
160_L	177_A	0.673	0.85
89_L	203_L	0.672	0.85
90_N	93_R	0.667	0.85
41_V	85_M	0.664	0.84
102_V	127_P	0.663	0.84
186_A	190_N	0.662	0.84
53_G	75_V	0.653	0.83
49_Q	68_Q	0.653	0.83
116_L	179_I	0.653	0.83
99_R	146_G	0.650	0.83
112_T	195_L	0.647	0.83
118_I	136_I	0.646	0.83
53_G	59_L	0.645	0.83
162_P	165_R	0.644	0.83
179_I	184_P	0.643	0.83
10_Q	196_L	0.643	0.83
108_T	195_L	0.641	0.82
130_Y	147_C	0.640	0.82
47_F	75_V	0.632	0.81
108_T	203_L	0.631	0.81
49_Q	55_A	0.631	0.81
19_I	41_V	0.630	0.81
64_I	165_R	0.627	0.81
104_L	108_T	0.627	0.81
192_A	196_L	0.625	0.81
96_L	104_L	0.623	0.81
126_A	174_M	0.620	0.80
164_L	175_E	0.618	0.80
131_V	182_W	0.618	0.80
126_A	171_Y	0.614	0.80
22_A	37_E	0.612	0.79
34_T	90_N	0.608	0.79
29_T	34_T	0.607	0.79
131_V	134_K	0.604	0.78
96_L	100_E	0.602	0.78
127_P	139_L	0.599	0.78
40_L	196_L	0.597	0.78
108_T	202_L	0.597	0.78
143_I	146_G	0.595	0.77
116_L	191_I	0.593	0.77
153_A	176_M	0.591	0.77
104_L	203_L	0.589	0.77
44_Y	84_V	0.588	0.77
175_E	181_Q	0.587	0.76
47_F	142_R	0.586	0.76
9_R	22_A	0.586	0.76
153_A	168_P	0.585	0.76
113_L	137_C	0.581	0.76
112_T	179_I	0.578	0.75
183_K	186_A	0.577	0.75
129_V	137_C	0.575	0.75
130_Y	174_M	0.574	0.75
99_R	127_P	0.571	0.74
88_L	147_C	0.569	0.74
18_P	22_A	0.568	0.74
60_M	75_V	0.561	0.73
38_I	199_I	0.560	0.73
40_L	112_T	0.558	0.73
70_D	141_L	0.558	0.73
58_I	61_P	0.558	0.73
162_P	178_K	0.556	0.73
28_D	144_R	0.555	0.72
112_T	186_A	0.553	0.72
193_P	196_L	0.552	0.72
101_L	105_L	0.551	0.72
90_N	146_G	0.548	0.71
136_I	182_W	0.548	0.71
61_P	64_I	0.546	0.71
197_E	201_A	0.544	0.71
40_L	152_L	0.543	0.71
191_I	194_R	0.543	0.71
99_R	122_P	0.541	0.71
120_A	129_V	0.540	0.70
197_E	200_L	0.540	0.70
120_A	131_V	0.538	0.70
103_T	124_A	0.537	0.70
193_P	198_N	0.536	0.70
178_K	182_W	0.535	0.70
135_K	169_C	0.535	0.70
88_L	130_Y	0.533	0.69
30_R	147_C	0.529	0.69
111_N	115_E	0.527	0.69
62_G	66_V	0.525	0.68
22_A	26_F	0.524	0.68
179_I	186_A	0.524	0.68
53_G	74_Q	0.524	0.68
156_V	179_I	0.519	0.67
85_M	199_I	0.519	0.67
164_L	172_A	0.514	0.67
16_Y	150_H	0.513	0.66
105_L	141_L	0.512	0.66
100_E	146_G	0.510	0.66
76_T	169_C	0.508	0.66
121_H	132_G	0.502	0.65
103_T	129_V	0.501	0.65
180_S	188_T	0.501	0.65
189_N	192_A	0.500	0.65

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1w66A	1	0.9671	100	0.36	Contact Map
2qhsA	1	0.9437	100	0.384	Contact Map
2p0lA	1	0.9859	100	0.5	Contact Map
2c8mA	1	0.9343	100	0.501	Contact Map
3a7rA	1	0.9484	100	0.528	Contact Map
2p5iA	1	0.9577	100	0.54	Contact Map
2e5aA	1	0.9484	100	0.547	Contact Map
1vqzA	1	0.9437	100	0.615	Contact Map
1biaA	1	0.8263	95.5	0.917	Contact Map
2dxuA	2	0.8216	95.1	0.919	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.