YOHJ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOHJ - UPF0299 membrane protein YohJ

UniProt:	P60632	Sequences: MSKTLNIIWQYLRAFVLIYACLYAGIFIASLLPVTIPGSIIGMLILFVLLALQILPAKWVNPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAVSTLVVFLVVSWSSQLVHGERKVVGQKGSEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12023
Length:	132 (112)
Sequences:	1825 (1377)
Seq/√Len:	130.1

ECOLI - YOHJ
BACSU - CIDA LRGA YXZK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_C	49_L	4.555	1.00
113_W	116_Q	2.849	1.00
110_V	114_S	2.755	1.00
48_V	52_L	2.652	1.00
109_L	113_W	2.428	1.00
112_S	116_Q	2.375	1.00
44_L	48_V	2.358	1.00
29_A	41_I	2.104	1.00
20_A	24_A	2.002	1.00
102_V	106_V	1.993	1.00
89_L	96_V	1.920	1.00
25_G	38_G	1.870	1.00
95_P	99_S	1.845	1.00
83_M	86_F	1.830	1.00
26_I	30_S	1.818	1.00
24_A	49_L	1.794	1.00
14_A	63_G	1.793	1.00
92_Q	95_P	1.783	1.00
22_L	26_I	1.707	1.00
21_C	45_I	1.706	1.00
39_S	74_L	1.672	1.00
41_I	45_I	1.672	1.00
13_R	59_W	1.630	1.00
22_L	39_S	1.595	1.00
114_S	117_L	1.572	1.00
113_W	117_L	1.516	1.00
56_P	59_W	1.508	1.00
57_A	60_V	1.492	1.00
37_P	78_I	1.478	1.00
27_F	31_L	1.431	1.00
117_L	121_E	1.420	1.00
98_V	102_V	1.375	1.00
82_V	85_Y	1.351	1.00
28_I	31_L	1.351	1.00
45_I	49_L	1.333	1.00
43_M	79_G	1.329	1.00
118_V	121_E	1.313	1.00
87_D	90_R	1.311	1.00
53_Q	56_P	1.268	1.00
115_S	119_H	1.190	0.99
85_Y	88_L	1.186	0.99
61_N	65_Y	1.185	0.99
29_A	33_P	1.153	0.99
25_G	41_I	1.114	0.99
44_L	66_V	1.109	0.99
86_F	90_R	1.107	0.99
57_A	61_N	1.095	0.99
28_I	45_I	1.094	0.99
21_C	25_G	1.085	0.99
100_C	107_V	1.081	0.99
43_M	115_S	1.079	0.99
29_A	32_L	1.027	0.98
88_L	92_Q	1.016	0.98
15_F	63_G	1.005	0.98
87_D	91_A	1.000	0.98
29_A	38_G	0.987	0.98
83_M	101_A	0.964	0.97
107_V	111_V	0.962	0.97
14_A	21_C	0.961	0.97
72_A	76_V	0.960	0.97
117_L	120_G	0.960	0.97
49_L	55_L	0.956	0.97
69_R	78_I	0.955	0.97
49_L	54_I	0.941	0.97
28_I	61_N	0.935	0.97
27_F	30_S	0.931	0.97
28_I	33_P	0.919	0.97
54_I	57_A	0.916	0.97
28_I	41_I	0.912	0.96
26_I	38_G	0.904	0.96
13_R	16_V	0.903	0.96
46_L	55_L	0.888	0.96
112_S	121_E	0.883	0.96
47_F	51_A	0.877	0.96
18_I	63_G	0.869	0.95
43_M	60_V	0.866	0.95
25_G	81_G	0.860	0.95
40_I	72_A	0.854	0.95
111_V	115_S	0.845	0.95
92_Q	96_V	0.840	0.94
24_A	45_I	0.834	0.94
104_T	107_V	0.833	0.94
55_L	59_W	0.821	0.94
61_N	81_G	0.821	0.94
15_F	25_G	0.801	0.93
40_I	68_I	0.790	0.92
19_Y	111_V	0.774	0.92
35_T	40_I	0.774	0.92
17_L	20_A	0.768	0.91
55_L	60_V	0.757	0.91
19_Y	81_G	0.754	0.90
48_V	114_S	0.753	0.90
116_Q	121_E	0.744	0.90
49_L	52_L	0.743	0.90
70_Y	73_L	0.737	0.89
68_I	71_M	0.735	0.89
39_S	108_F	0.734	0.89
67_L	72_A	0.725	0.89
75_F	78_I	0.724	0.89
72_A	79_G	0.721	0.88
44_L	47_F	0.720	0.88
79_G	86_F	0.709	0.88
38_G	41_I	0.707	0.87
60_V	68_I	0.705	0.87
105_L	109_L	0.700	0.87
29_A	34_V	0.698	0.87
28_I	32_L	0.698	0.87
80_V	83_M	0.698	0.87
84_Q	87_D	0.692	0.86
13_R	17_L	0.692	0.86
100_C	104_T	0.690	0.86
55_L	71_M	0.686	0.86
33_P	44_L	0.680	0.85
22_L	37_P	0.676	0.85
11_Y	62_P	0.673	0.85
57_A	64_C	0.662	0.84
104_T	108_F	0.661	0.84
15_F	103_S	0.657	0.83
58_K	67_L	0.653	0.83
12_L	122_R	0.645	0.82
72_A	103_S	0.644	0.82
79_G	82_V	0.639	0.82
99_S	108_F	0.634	0.81
14_A	66_V	0.621	0.80
115_S	118_V	0.615	0.79
32_L	41_I	0.607	0.78
30_S	89_L	0.604	0.78
64_C	105_L	0.604	0.78
36_I	42_G	0.597	0.77
46_L	60_V	0.593	0.77
13_R	58_K	0.593	0.77
88_L	96_V	0.588	0.76
31_L	101_A	0.586	0.76
27_F	101_A	0.586	0.76
19_Y	25_G	0.584	0.76
66_V	71_M	0.582	0.75
18_I	59_W	0.582	0.75
71_M	107_V	0.581	0.75
73_L	76_V	0.580	0.75
23_Y	105_L	0.578	0.75
79_G	85_Y	0.577	0.75
58_K	117_L	0.565	0.73
54_I	58_K	0.560	0.72
12_L	31_L	0.557	0.72
53_Q	57_A	0.556	0.72
73_L	88_L	0.550	0.71
61_N	107_V	0.550	0.71
56_P	102_V	0.549	0.71
80_V	87_D	0.542	0.70
99_S	109_L	0.536	0.69
19_Y	80_V	0.529	0.68
40_I	104_T	0.528	0.68
49_L	53_Q	0.527	0.68
40_I	85_Y	0.527	0.68
36_I	81_G	0.526	0.68
58_K	61_N	0.526	0.68
40_I	80_V	0.520	0.67
11_Y	82_V	0.519	0.67
51_A	54_I	0.518	0.67
63_G	85_Y	0.517	0.66
38_G	81_G	0.515	0.66
22_L	115_S	0.514	0.66
25_G	45_I	0.510	0.65
17_L	49_L	0.507	0.65
13_R	90_R	0.506	0.65
60_V	64_C	0.503	0.64
70_Y	74_L	0.502	0.64
71_M	75_F	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4bwzA	2	0.9091	58.6	0.903	Contact Map
4mt1A	3	0.9015	57.2	0.904	Contact Map
2kncA	1	0.3864	52.2	0.907	Contact Map
4k0jA	3	0.8864	48.4	0.908	Contact Map
4cz8A	2	0.9318	47	0.909	Contact Map
4czbA	2	0.9318	39.8	0.913	Contact Map
2kv5A	1	0.25	39.3	0.913	Contact Map
4dx5A	3	0.9773	39.3	0.913	Contact Map
3w9iA	3	0.9394	37.6	0.914	Contact Map
3ne5A	3	0.9318	36.2	0.915	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.