INSB4 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

INSB4 - Insertion element IS1 4 protein InsB

UniProt:	P57998	Sequences: MPGNSPHYGRWPQHDFPPFKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERYNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG40002
Length:	167 (133)
Sequences:	188 (147)
Seq/√Len:	12.7

ECOLI - INSB4 INSB2 INSB3 INSB1 INSB5 INSB6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_E	65_R	3.454	0.99
134_Q	144_L	3.157	0.97
65_R	124_R	3.082	0.97
137_A	144_L	2.911	0.96
135_H	160_Y	2.640	0.93
49_Y	88_S	2.563	0.91
149_S	152_L	2.518	0.91
48_G	153_H	2.406	0.89
98_W	110_L	2.352	0.87
58_W	62_A	2.180	0.83
134_Q	137_A	2.124	0.81
49_Y	85_R	1.895	0.73
134_Q	145_S	1.787	0.68
127_R	131_N	1.763	0.67
46_Q	59_L	1.758	0.67
57_R	154_D	1.756	0.67
61_Y	129_N	1.717	0.65
63_Y	128_Y	1.662	0.62
58_W	86_L	1.641	0.61
127_R	130_L	1.627	0.61
43_M	100_T	1.618	0.60
74_V	82_T	1.617	0.60
80_M	108_S	1.592	0.59
49_Y	66_L	1.584	0.58
157_I	161_L	1.555	0.57
68_K	128_Y	1.529	0.56
130_L	144_L	1.514	0.55
128_Y	134_Q	1.489	0.54
139_L	144_L	1.478	0.53
48_G	127_R	1.478	0.53
140_G	146_F	1.468	0.53
122_T	138_R	1.467	0.52
125_I	139_L	1.455	0.52
83_L	109_R	1.428	0.50
49_Y	60_F	1.360	0.47
65_R	159_H	1.351	0.46
80_M	84_G	1.350	0.46
42_E	124_R	1.348	0.46
105_L	118_S	1.344	0.46
130_L	140_G	1.333	0.46
50_V	153_H	1.330	0.45
63_Y	68_K	1.314	0.45
130_L	134_Q	1.279	0.43
42_E	122_T	1.276	0.43
58_W	143_S	1.274	0.43
125_I	159_H	1.257	0.42
61_Y	155_K	1.205	0.39
47_W	164_K	1.175	0.38
64_D	146_F	1.167	0.37
64_D	145_S	1.160	0.37
101_D	126_E	1.160	0.37
74_V	150_V	1.153	0.37
131_N	135_H	1.139	0.36
39_V	49_Y	1.130	0.35
44_D	138_R	1.129	0.35
61_Y	115_H	1.128	0.35
50_V	147_S	1.123	0.35
130_L	137_A	1.119	0.35
59_L	158_G	1.106	0.34
63_Y	67_R	1.102	0.34
84_G	117_I	1.082	0.33
106_Y	126_E	1.080	0.33
72_A	86_L	1.072	0.33
42_E	119_K	1.070	0.33
47_W	122_T	1.067	0.33
47_W	146_F	1.064	0.32
139_L	157_I	1.064	0.32
97_I	116_V	1.062	0.32
67_R	92_P	1.055	0.32
57_R	150_V	1.036	0.31
131_N	160_Y	1.031	0.31
59_L	93_F	1.023	0.31
47_W	86_L	1.014	0.30
134_Q	140_G	0.993	0.29
128_Y	144_L	0.986	0.29
33_P	36_D	0.982	0.29
137_A	145_S	0.980	0.29
70_V	143_S	0.973	0.28
89_L	93_F	0.970	0.28
126_E	133_R	0.970	0.28
136_L	149_S	0.958	0.28
51_G	81_A	0.956	0.28
128_Y	136_L	0.949	0.27
43_M	161_L	0.935	0.27
63_Y	100_T	0.931	0.27
50_V	117_I	0.931	0.27
87_M	162_N	0.931	0.27
146_F	153_H	0.924	0.26
80_M	104_P	0.922	0.26
63_Y	82_T	0.915	0.26
80_M	145_S	0.913	0.26
135_H	153_H	0.904	0.26
63_Y	124_R	0.891	0.25
93_F	123_Q	0.884	0.25
43_M	120_R	0.877	0.25
88_S	100_T	0.874	0.24
46_Q	132_L	0.857	0.24
91_S	96_V	0.845	0.23
74_V	86_L	0.809	0.22
45_E	53_K	0.809	0.22
67_R	128_Y	0.804	0.22
66_L	161_L	0.801	0.22
34_G	37_V	0.799	0.22
95_V	130_L	0.793	0.22
63_Y	165_H	0.785	0.21
93_F	158_G	0.782	0.21
90_L	156_V	0.781	0.21
137_A	140_G	0.773	0.21
40_C	121_Y	0.764	0.21
43_M	152_L	0.763	0.20
51_G	71_V	0.755	0.20
152_L	156_V	0.753	0.20
67_R	165_H	0.752	0.20
92_P	108_S	0.750	0.20
77_E	82_T	0.748	0.20
82_T	157_I	0.747	0.20
42_E	103_W	0.729	0.19
62_A	147_S	0.728	0.19
149_S	156_V	0.726	0.19
71_V	85_R	0.720	0.19
56_Q	89_L	0.718	0.19
50_V	57_R	0.715	0.19
54_S	85_R	0.699	0.18
123_Q	127_R	0.697	0.18
37_V	125_I	0.685	0.18
56_Q	117_I	0.683	0.18
73_H	159_H	0.682	0.18
84_G	108_S	0.680	0.18
61_Y	125_I	0.680	0.18
101_D	106_Y	0.680	0.18
57_R	110_L	0.671	0.18
158_G	163_I	0.670	0.18
147_S	153_H	0.670	0.18
106_Y	143_S	0.670	0.18
121_Y	142_K	0.668	0.17
50_V	103_W	0.666	0.17
138_R	147_S	0.666	0.17
92_P	125_I	0.658	0.17
46_Q	123_Q	0.655	0.17
68_K	130_L	0.651	0.17
57_R	70_V	0.650	0.17
110_L	154_D	0.646	0.17
38_I	73_H	0.643	0.17
42_E	45_E	0.641	0.17
52_A	64_D	0.639	0.17
160_Y	164_K	0.635	0.17
101_D	138_R	0.635	0.17
62_A	70_V	0.632	0.16
68_K	124_R	0.632	0.16
48_G	131_N	0.622	0.16
54_S	99_M	0.622	0.16
77_E	81_A	0.619	0.16
53_K	106_Y	0.616	0.16
131_N	164_K	0.613	0.16
134_Q	139_L	0.612	0.16
59_L	75_F	0.610	0.16
99_M	151_E	0.603	0.16
38_I	102_G	0.602	0.16
51_G	151_E	0.602	0.16
59_L	90_L	0.597	0.15
99_M	136_L	0.596	0.15
83_L	165_H	0.594	0.15
41_A	165_H	0.593	0.15
90_L	137_A	0.591	0.15
70_V	76_G	0.590	0.15
98_W	150_V	0.586	0.15
124_R	132_L	0.582	0.15
87_M	110_L	0.581	0.15
40_C	65_R	0.581	0.15
86_L	142_K	0.578	0.15
60_F	133_R	0.576	0.15
75_F	78_R	0.574	0.15
132_L	136_L	0.570	0.15
49_Y	74_V	0.569	0.15
51_G	107_E	0.568	0.15
52_A	98_W	0.568	0.15
59_L	157_I	0.566	0.15
85_R	105_L	0.565	0.15
44_D	53_K	0.560	0.14
58_W	105_L	0.559	0.14
63_Y	164_K	0.557	0.14
99_M	110_L	0.556	0.14
79_T	87_M	0.549	0.14
54_S	88_S	0.548	0.14
125_I	153_H	0.544	0.14
70_V	131_N	0.540	0.14
77_E	91_S	0.539	0.14
71_V	78_R	0.534	0.14
106_Y	127_R	0.533	0.14
123_Q	158_G	0.528	0.14
62_A	138_R	0.522	0.14
86_L	117_I	0.512	0.13
98_W	105_L	0.512	0.13
115_H	132_L	0.507	0.13
68_K	164_K	0.506	0.13
151_E	155_K	0.504	0.13
48_G	122_T	0.502	0.13
68_K	134_Q	0.501	0.13
128_Y	165_H	0.501	0.13
160_Y	163_I	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4fcyA	4	0.982	97.8	0.864	Contact Map
1bcoA	1	0.8024	97.5	0.872	Contact Map
4fw1A	2	0.8024	97.4	0.872	Contact Map
3l3uA	2	0.7066	97.4	0.874	Contact Map
1cxqA	2	0.7665	97.2	0.877	Contact Map
4mq3A	1	0.7006	97.2	0.878	Contact Map
4cf8A	2	0.7066	97.1	0.88	Contact Map
1c6vA	4	0.6647	96.9	0.882	Contact Map
4pa1A	2	0.7066	96.6	0.887	Contact Map
1ex4A	5	0.7006	96.6	0.887	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.