DLHH - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DLHH - Putative carboxymethylenebutenolidase

UniProt:	P56262	Sequences: MATTQQSGFAPAASPLASTIVQTPDDAIVAGFTSIPSQGDNMPAYHARPKQSDGPLPVVIVVQEIFGVHEHIRDICRRLALEGYLAIAPELYFREGDPNDFADIPTLLSGLVAKVPDSQVLADLDHVASWASRNGGDVHRLMITGFCWGGRITWLYAAHNPQLKAAVAWYGKLTGDKSLNSPKQPVDIATDLNAPILGLYGGQDNSIPQESVETMRQALRAANAKAEIIVYPDAGHAFNADYRPSYHAASAEDGWQRMLEWFKQYGGKKSL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14321
Length:	271 (215)
Sequences:	34281 (24235)
Seq/√Len:	1652.8

ECOLI - DLHH YGHX FRSA YJFP PTRB YFHR YCJY PLDB YIEL AES
BACSU - YUXL CAH YTAP YTMA YITV YQKD YCZH
HALSA - Q9HN07 Q9HPY2 Q9HS46 Q9HP29
SULSO - Q97VD6 Q97YB2 Q7LX61 DLHH Q97VT8 Q97VW1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
142_M	165_A	3.511	1.00
157_A	166_A	3.473	1.00
92_Y	123_D	3.384	1.00
34_S	41_N	2.727	1.00
130_W	134_N	2.571	1.00
202_G	232_P	2.435	1.00
213_E	230_V	2.330	1.00
82_E	259_L	2.264	1.00
36_P	41_N	2.201	1.00
137_D	140_R	2.176	1.00
216_R	226_A	2.165	1.00
168_A	171_G	2.165	1.00
229_I	257_R	2.159	1.00
62_V	124_L	2.155	1.00
227_E	257_R	2.144	1.00
153_T	166_A	2.102	1.00
49_P	85_L	2.040	1.00
128_A	163_L	2.008	1.00
58_V	136_G	1.984	1.00
56_L	85_L	1.978	1.00
142_M	262_F	1.967	1.00
44_A	87_I	1.947	1.00
167_V	258_M	1.943	1.00
58_V	131_A	1.943	1.00
84_Y	263_K	1.918	1.00
231_Y	257_R	1.908	1.00
143_I	153_T	1.860	1.00
33_T	44_A	1.826	1.00
31_G	48_R	1.805	1.00
78_R	82_E	1.764	1.00
58_V	85_L	1.764	1.00
46_H	85_L	1.744	1.00
48_R	85_L	1.706	1.00
154_W	168_A	1.675	1.00
202_G	230_V	1.668	1.00
209_Q	230_V	1.656	1.00
82_E	263_K	1.632	1.00
188_I	191_D	1.622	1.00
87_I	131_A	1.588	1.00
253_D	257_R	1.585	1.00
167_V	262_F	1.579	1.00
256_Q	260_E	1.579	1.00
130_W	133_R	1.533	1.00
59_V	84_Y	1.524	1.00
64_E	147_C	1.522	1.00
146_F	170_Y	1.517	1.00
227_E	264_Q	1.511	1.00
125_D	129_S	1.500	1.00
85_L	136_G	1.490	1.00
216_R	228_I	1.486	1.00
217_Q	221_A	1.477	1.00
49_P	56_L	1.475	1.00
87_I	127_V	1.461	1.00
203_Q	233_D	1.408	1.00
46_H	87_I	1.400	1.00
35_I	127_V	1.398	1.00
125_D	160_N	1.393	1.00
216_R	220_R	1.387	1.00
202_G	233_D	1.373	1.00
213_E	217_Q	1.369	1.00
231_Y	253_D	1.357	1.00
219_L	224_A	1.345	1.00
165_A	265_Y	1.321	1.00
143_I	156_Y	1.319	1.00
47_A	88_A	1.312	1.00
59_V	144_T	1.306	1.00
124_L	156_Y	1.277	1.00
200_Y	212_V	1.251	1.00
257_R	260_E	1.245	1.00
58_V	87_I	1.228	1.00
128_A	141_L	1.200	1.00
140_R	164_K	1.193	1.00
198_G	216_R	1.177	1.00
146_F	169_W	1.173	1.00
61_V	76_C	1.171	1.00
77_R	81_L	1.164	1.00
200_Y	209_Q	1.157	1.00
122_A	159_H	1.154	1.00
199_L	229_I	1.147	1.00
168_A	198_G	1.144	1.00
167_V	197_L	1.144	1.00
61_V	144_T	1.142	1.00
166_A	196_I	1.139	1.00
35_I	44_A	1.139	1.00
32_F	43_P	1.135	1.00
44_A	127_V	1.130	1.00
117_D	120_V	1.128	1.00
213_E	228_I	1.128	1.00
214_T	217_Q	1.122	1.00
129_S	133_R	1.120	1.00
196_I	219_L	1.120	1.00
220_R	226_A	1.118	1.00
225_K	265_Y	1.107	1.00
154_W	215_M	1.104	1.00
198_G	212_V	1.090	1.00
209_Q	213_E	1.088	1.00
89_P	127_V	1.083	1.00
218_A	222_A	1.083	1.00
129_S	162_Q	1.078	1.00
76_C	88_A	1.077	1.00
34_S	43_P	1.074	1.00
169_W	258_M	1.071	1.00
121_L	155_L	1.069	1.00
184_Q	187_D	1.068	1.00
197_L	229_I	1.065	1.00
231_Y	234_A	1.064	1.00
125_D	159_H	1.062	1.00
218_A	221_A	1.054	1.00
129_S	160_N	1.043	1.00
60_I	128_A	1.033	1.00
73_R	77_R	1.031	1.00
126_H	129_S	1.021	1.00
52_S	56_L	1.017	1.00
144_T	167_V	1.015	1.00
261_W	265_Y	1.013	1.00
31_G	134_N	1.003	1.00
199_L	231_Y	0.996	1.00
55_P	137_D	0.989	1.00
165_A	261_W	0.988	1.00
33_T	130_W	0.987	1.00
29_V	48_R	0.987	1.00
125_D	156_Y	0.984	1.00
37_S	40_D	0.981	1.00
252_E	256_Q	0.975	1.00
65_I	148_W	0.973	1.00
63_Q	91_L	0.963	1.00
60_I	127_V	0.952	1.00
259_L	263_K	0.950	1.00
62_V	91_L	0.948	1.00
200_Y	230_V	0.947	1.00
170_Y	238_F	0.940	1.00
139_H	164_K	0.932	1.00
62_V	143_I	0.928	1.00
78_R	81_L	0.926	1.00
61_V	86_A	0.919	1.00
59_V	79_L	0.918	1.00
57_P	137_D	0.917	1.00
200_Y	228_I	0.914	1.00
155_L	159_H	0.909	1.00
115_V	118_S	0.906	1.00
165_A	262_F	0.905	1.00
57_P	140_R	0.904	1.00
76_C	80_A	0.899	1.00
154_W	196_I	0.898	1.00
143_I	166_A	0.892	1.00
52_S	55_P	0.892	1.00
62_V	89_P	0.891	1.00
198_G	215_M	0.884	1.00
124_L	152_I	0.877	1.00
181_S	187_D	0.877	1.00
38_Q	92_Y	0.872	1.00
219_L	226_A	0.861	1.00
43_P	90_E	0.861	1.00
118_S	122_A	0.850	1.00
186_V	189_A	0.849	1.00
166_A	194_A	0.847	1.00
144_T	169_W	0.843	1.00
254_G	258_M	0.843	1.00
78_R	255_W	0.831	1.00
32_F	45_Y	0.830	1.00
197_L	261_W	0.825	1.00
58_V	141_L	0.823	1.00
45_Y	69_H	0.819	1.00
157_A	194_A	0.818	1.00
154_W	171_G	0.815	1.00
199_L	254_G	0.813	1.00
150_G	171_G	0.805	1.00
119_Q	122_A	0.804	1.00
170_Y	237_A	0.802	1.00
67_G	151_R	0.802	1.00
184_Q	188_I	0.801	1.00
195_P	225_K	0.799	1.00
253_D	256_Q	0.796	1.00
47_A	86_A	0.795	1.00
29_V	50_K	0.794	1.00
61_V	72_I	0.794	1.00
202_G	209_Q	0.792	1.00
132_S	164_K	0.788	1.00
195_P	265_Y	0.787	1.00
260_E	264_Q	0.787	1.00
122_A	126_H	0.785	1.00
214_T	218_A	0.785	1.00
41_N	98_P	0.783	1.00
37_S	126_H	0.781	1.00
132_S	162_Q	0.772	1.00
190_T	218_A	0.770	1.00
53_D	56_L	0.769	1.00
51_Q	56_L	0.767	1.00
38_Q	122_A	0.764	1.00
167_V	199_L	0.760	1.00
150_G	168_A	0.760	1.00
132_S	135_G	0.758	1.00
210_E	213_E	0.746	1.00
120_V	152_I	0.744	1.00
187_D	190_T	0.741	1.00
59_V	142_M	0.739	1.00
229_I	253_D	0.739	1.00
137_D	164_K	0.736	1.00
142_M	164_K	0.731	1.00
79_L	144_T	0.730	1.00
200_Y	207_I	0.728	1.00
30_A	47_A	0.726	1.00
47_A	80_A	0.725	1.00
84_Y	262_F	0.722	1.00
82_E	256_Q	0.722	1.00
170_Y	201_G	0.722	1.00
30_A	45_Y	0.720	1.00
143_I	163_L	0.718	1.00
59_V	262_F	0.710	1.00
129_S	132_S	0.707	1.00
158_A	192_L	0.707	1.00
91_L	148_W	0.703	1.00
132_S	138_V	0.702	1.00
170_Y	239_N	0.701	1.00
151_R	155_L	0.694	1.00
100_D	103_D	0.689	1.00
158_A	188_I	0.687	1.00
128_A	132_S	0.685	1.00
80_A	86_A	0.684	1.00
33_T	46_H	0.684	1.00
153_T	157_A	0.683	1.00
60_I	163_L	0.682	1.00
79_L	258_M	0.682	1.00
171_G	200_Y	0.680	1.00
223_N	226_A	0.679	1.00
35_I	126_H	0.672	1.00
69_H	90_E	0.670	1.00
260_E	263_K	0.667	1.00
142_M	265_Y	0.666	1.00
153_T	168_A	0.665	1.00
61_V	88_A	0.664	1.00
78_R	259_L	0.664	1.00
170_Y	204_D	0.664	1.00
190_T	222_A	0.663	1.00
62_V	152_I	0.661	1.00
44_A	130_W	0.659	1.00
63_Q	94_R	0.656	1.00
155_L	158_A	0.654	1.00
84_Y	142_M	0.652	1.00
166_A	215_M	0.650	1.00
180_N	183_K	0.649	1.00
132_S	141_L	0.645	1.00
169_W	199_L	0.644	1.00
62_V	153_T	0.637	1.00
179_L	182_P	0.634	1.00
144_T	258_M	0.629	1.00
78_R	252_E	0.629	1.00
27_A	81_L	0.629	1.00
212_V	216_R	0.625	1.00
183_K	186_V	0.623	1.00
59_V	86_A	0.623	1.00
57_P	84_Y	0.622	1.00
84_Y	259_L	0.621	1.00
65_I	91_L	0.619	1.00
37_S	42_M	0.612	1.00
48_R	56_L	0.611	1.00
217_Q	220_R	0.609	1.00
60_I	87_I	0.609	1.00
80_A	85_L	0.608	1.00
197_L	227_E	0.603	1.00
125_D	163_L	0.601	1.00
251_A	254_G	0.601	1.00
99_N	103_D	0.599	1.00
197_L	257_R	0.597	1.00
185_P	188_I	0.596	1.00
44_A	89_P	0.595	1.00
125_D	128_A	0.591	1.00
212_V	228_I	0.588	1.00
213_E	216_R	0.587	1.00
40_D	98_P	0.586	1.00
51_Q	54_G	0.585	1.00
211_S	214_T	0.583	1.00
94_R	97_D	0.583	1.00
154_W	166_A	0.581	1.00
132_S	136_G	0.578	1.00
169_W	254_G	0.574	1.00
47_A	77_R	0.573	1.00
122_A	125_D	0.573	1.00
37_S	122_A	0.572	1.00
209_Q	228_I	0.571	1.00
196_I	224_A	0.571	1.00
198_G	226_A	0.571	1.00
57_P	139_H	0.563	1.00
118_S	159_H	0.562	1.00
121_L	125_D	0.560	1.00
76_C	86_A	0.559	1.00
164_K	195_P	0.556	1.00
148_W	152_I	0.549	1.00
255_W	258_M	0.548	1.00
189_A	192_L	0.548	1.00
89_P	124_L	0.548	1.00
205_N	235_G	0.547	1.00
196_I	215_M	0.544	1.00
33_T	87_I	0.539	1.00
72_I	146_F	0.539	1.00
43_P	97_D	0.538	1.00
144_T	168_A	0.534	1.00
91_L	94_R	0.534	1.00
47_A	73_R	0.533	1.00
210_E	214_T	0.531	1.00
61_V	146_F	0.531	1.00
121_L	152_I	0.530	1.00
47_A	76_C	0.530	1.00
147_C	236_H	0.530	1.00
63_Q	147_C	0.525	1.00
128_A	156_Y	0.524	1.00
159_H	188_I	0.524	1.00
208_P	211_S	0.523	1.00
227_E	230_V	0.523	1.00
205_N	209_Q	0.522	1.00
58_V	142_M	0.521	1.00
131_A	134_N	0.520	1.00
258_M	262_F	0.520	1.00
45_Y	73_R	0.519	1.00
189_A	222_A	0.516	1.00
166_A	171_G	0.513	1.00
49_P	80_A	0.512	1.00
79_L	259_L	0.511	1.00
181_S	184_Q	0.510	1.00
158_A	215_M	0.506	1.00
144_T	262_F	0.504	1.00
157_A	196_I	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3f67A	1	0.8856	100	0.334	Contact Map
1xfdA	2	0.9373	100	0.351	Contact Map
4wjlA	2	0.9336	100	0.351	Contact Map
2ecfA	2	0.9336	100	0.364	Contact Map
2z3zA	2	0.8967	100	0.365	Contact Map
4a5sA	2	0.9483	100	0.366	Contact Map
4q1vA	2	0.9188	100	0.368	Contact Map
4zv9A	1	0.8672	100	0.369	Contact Map
4hxfB	4	0.9557	100	0.371	Contact Map
1z68A	2	0.9299	100	0.373	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0088 seconds.