USPC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

USPC - Universal stress protein C

UniProt:	P46888	Sequences: MSYSNILVAVAVTPESQQLLAKAVSIARPVKGHISLITLASDPEMYNQLAAPMLEDLRSVMHEETQSFLDKLIQDAGYPVDKTFIAYGELSEHILEVCHKHHFDLVICGNHNHSFFSRASCSAKRVIASSEVDVLLVPLTGD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12862
Length:	142 (131)
Sequences:	20422 (16676)
Seq/√Len:	1456.9

ECOLI - USPC USPD USPA USPE USPF USPG
BACSU - NHAX YXIE
HALSA - Q9HPP5 Q9HRP5 Q9HMJ0 Q9HPQ8 Q9HRD8 Q9HMI9 Q9HPF7 Q9HP90 Q9HHV8 Q9HHX5 Q9HHY0 Q9HNX9 Q9HMU1
SULSO - Q97X90 Q97V57 Q7LXW4 Q97U40

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_S	84_F	2.934	1.00
5_N	35_S	2.862	1.00
7_L	103_F	2.838	1.00
91_S	125_R	2.751	1.00
22_K	135_L	2.597	1.00
5_N	33_H	2.462	1.00
105_L	135_L	2.352	1.00
33_H	82_K	2.343	1.00
84_F	97_V	2.162	1.00
106_V	132_V	2.121	1.00
62_H	66_Q	2.084	1.00
97_V	101_H	1.980	1.00
108_C	126_V	1.960	1.00
124_K	128_A	1.958	1.00
35_S	103_F	1.852	1.00
110_N	138_P	1.833	1.00
88_G	93_H	1.828	1.00
8_V	23_A	1.805	1.00
86_A	93_H	1.792	1.00
35_S	101_H	1.777	1.00
37_I	97_V	1.752	1.00
9_A	108_C	1.712	1.00
35_S	97_V	1.701	1.00
39_L	93_H	1.694	1.00
9_A	94_I	1.653	1.00
35_S	82_K	1.606	1.00
5_N	104_D	1.553	1.00
70_D	74_Q	1.531	1.00
98_C	106_V	1.527	1.00
26_I	30_V	1.513	1.00
93_H	96_E	1.505	1.00
21_A	72_L	1.462	1.00
106_V	130_S	1.435	1.00
125_R	129_S	1.421	1.00
65_T	69_L	1.414	1.00
32_G	104_D	1.384	1.00
95_L	129_S	1.374	1.00
8_V	20_L	1.359	1.00
33_H	79_P	1.290	1.00
66_Q	70_D	1.287	1.00
23_A	27_A	1.285	1.00
68_F	71_K	1.275	1.00
70_D	83_T	1.254	1.00
90_L	122_S	1.209	1.00
106_V	126_V	1.192	1.00
86_A	97_V	1.191	1.00
65_T	68_F	1.185	1.00
97_V	100_K	1.138	1.00
17_Q	72_L	1.122	1.00
116_F	120_S	1.118	1.00
58_R	62_H	1.110	1.00
50_A	53_M	1.095	1.00
61_M	65_T	1.090	1.00
72_L	75_D	1.089	1.00
73_I	76_A	1.086	1.00
110_N	136_L	1.085	1.00
39_L	90_L	1.072	1.00
22_K	137_V	1.071	1.00
37_I	86_A	1.061	1.00
63_E	67_S	1.057	1.00
130_S	134_V	1.047	1.00
17_Q	68_F	1.012	1.00
72_L	76_A	1.011	1.00
5_N	103_F	1.004	1.00
108_C	123_A	0.992	1.00
62_H	65_T	0.990	1.00
25_S	29_P	0.988	1.00
37_I	94_I	0.981	1.00
27_A	34_I	0.966	1.00
118_R	124_K	0.964	1.00
68_F	72_L	0.964	1.00
12_V	38_T	0.964	1.00
5_N	101_H	0.942	1.00
40_A	87_Y	0.936	1.00
16_S	19_L	0.936	1.00
127_I	136_L	0.931	1.00
97_V	103_F	0.925	1.00
22_K	26_I	0.921	1.00
51_A	54_L	0.919	1.00
6_I	105_L	0.918	1.00
61_M	64_E	0.914	1.00
23_A	107_I	0.901	1.00
67_S	70_D	0.887	1.00
53_M	56_D	0.883	1.00
58_R	61_M	0.876	1.00
22_K	133_D	0.873	1.00
113_H	117_S	0.869	1.00
30_V	104_D	0.864	1.00
20_L	36_L	0.862	1.00
59_S	63_E	0.857	1.00
22_K	25_S	0.855	1.00
64_E	68_F	0.852	1.00
66_Q	83_T	0.846	1.00
66_Q	69_L	0.844	1.00
10_V	19_L	0.841	1.00
55_E	59_S	0.837	1.00
10_V	36_L	0.836	1.00
13_T	16_S	0.834	1.00
98_C	132_V	0.828	1.00
110_N	123_A	0.826	1.00
115_F	118_R	0.809	1.00
7_L	37_I	0.807	1.00
67_S	71_K	0.803	1.00
96_E	100_K	0.802	1.00
7_L	97_V	0.798	1.00
38_T	65_T	0.798	1.00
17_Q	21_A	0.794	1.00
98_C	103_F	0.793	1.00
59_S	62_H	0.792	1.00
123_A	136_L	0.791	1.00
23_A	34_I	0.781	1.00
28_R	77_G	0.779	1.00
71_K	75_D	0.774	1.00
64_E	67_S	0.764	1.00
95_L	130_S	0.764	1.00
80_V	83_T	0.761	1.00
89_E	92_E	0.759	1.00
115_F	119_A	0.757	1.00
10_V	20_L	0.755	1.00
95_L	126_V	0.752	1.00
36_L	80_V	0.749	1.00
55_E	58_R	0.747	1.00
9_A	109_G	0.745	1.00
66_Q	72_L	0.743	1.00
28_R	76_A	0.741	1.00
71_K	74_Q	0.736	1.00
20_L	24_V	0.724	1.00
107_I	135_L	0.713	1.00
7_L	106_V	0.713	1.00
24_V	78_Y	0.711	1.00
10_V	17_Q	0.709	1.00
56_D	60_V	0.709	1.00
86_A	100_K	0.702	1.00
70_D	73_I	0.699	1.00
36_L	69_L	0.698	1.00
18_Q	21_A	0.696	1.00
69_L	73_I	0.695	1.00
40_A	85_I	0.685	1.00
37_I	93_H	0.685	1.00
8_V	34_I	0.682	1.00
60_V	64_E	0.670	1.00
27_A	30_V	0.669	1.00
108_C	136_L	0.669	1.00
24_V	28_R	0.663	1.00
77_G	80_V	0.661	1.00
26_I	29_P	0.656	1.00
13_T	112_N	0.649	1.00
25_S	28_R	0.648	1.00
24_V	76_A	0.641	1.00
52_P	55_E	0.640	1.00
84_F	101_H	0.638	1.00
27_A	32_G	0.631	1.00
8_V	19_L	0.622	1.00
93_H	97_V	0.622	1.00
54_L	57_L	0.616	1.00
38_T	62_H	0.614	1.00
111_H	123_A	0.610	1.00
91_S	122_S	0.608	1.00
102_H	132_V	0.602	1.00
51_A	55_E	0.594	1.00
95_L	98_C	0.591	1.00
23_A	32_G	0.587	1.00
6_I	107_I	0.586	1.00
66_Q	73_I	0.586	1.00
91_S	95_L	0.583	1.00
60_V	63_E	0.582	1.00
127_I	134_V	0.580	1.00
5_N	32_G	0.574	1.00
6_I	27_A	0.573	1.00
91_S	129_S	0.570	1.00
65_T	76_A	0.569	1.00
10_V	16_S	0.568	1.00
73_I	83_T	0.568	1.00
73_I	80_V	0.552	1.00
107_I	137_V	0.547	1.00
91_S	126_V	0.547	1.00
112_N	115_F	0.547	1.00
50_A	54_L	0.545	1.00
68_F	73_I	0.544	1.00
15_E	18_Q	0.537	1.00
25_S	76_A	0.532	1.00
63_E	66_Q	0.531	1.00
94_I	126_V	0.531	1.00
21_A	75_D	0.530	1.00
54_L	58_R	0.528	1.00
95_L	125_R	0.527	1.00
26_I	107_I	0.523	1.00
116_F	119_A	0.520	1.00
52_P	56_D	0.517	1.00
62_H	85_I	0.515	1.00
92_E	96_E	0.513	1.00
46_Y	49_L	0.509	1.00
69_L	72_L	0.503	1.00
21_A	76_A	0.502	1.00
14_P	17_Q	0.502	1.00
87_Y	93_H	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jmvA	4	0.9789	99.9	0.18	Contact Map
3tnjA	2	0.8944	99.9	0.186	Contact Map
4wnyA	2	0.8803	99.9	0.213	Contact Map
5ahwA	4	0.9789	99.9	0.215	Contact Map
2dumA	2	0.9577	99.9	0.217	Contact Map
3s3tA	4	0.9648	99.9	0.219	Contact Map
1mjhA	2	0.9507	99.9	0.226	Contact Map
2z08A	4	0.8521	99.9	0.244	Contact Map
1tq8A	4	0.8592	99.9	0.249	Contact Map
2gm3A	2	0.8873	99.8	0.25	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.