YHHY - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YHHY - Uncharacterized N-acetyltransferase YhhY

UniProt:	P46854	Sequences: MSEIVIRHAETRDYEAIRQIHAQPEVYCNTLQVPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWLRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMARVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12945
Length:	162 (154)
Sequences:	20957 (16291)
Seq/√Len:	1312.8

ECOLI - YHHY ATDA RIML RIMJ MNAT RIMI
BACSU - YOAA YDAF YJCK YOKL YNAD YKKB YJDG YWNH PAIA YHFO
HALSA - Q9HNJ3 Q9HMZ2 Q9HRY6 Q9HRY5 Q9HSL3 Q9HMI8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
97_S	133_K	2.901	1.00
118_L	131_Y	2.786	1.00
138_I	141_T	2.505	1.00
7_R	13_D	2.382	1.00
139_E	159_A	2.303	1.00
138_I	156_Y	2.295	1.00
120_V	128_I	2.252	1.00
68_I	107_C	2.224	1.00
80_A	113_V	2.213	1.00
104_I	136_F	2.125	1.00
128_I	132_K	2.009	1.00
25_E	88_S	2.005	1.00
129_K	132_K	1.956	1.00
120_V	131_Y	1.936	1.00
114_D	144_K	1.890	1.00
82_F	100_M	1.873	1.00
141_T	156_Y	1.864	1.00
105_E	109_N	1.840	1.00
16_A	62_V	1.795	1.00
38_D	42_Q	1.787	1.00
104_I	116_I	1.755	1.00
23_Q	88_S	1.725	1.00
87_D	90_W	1.722	1.00
147_L	152_Y	1.714	1.00
66_L	99_L	1.648	1.00
100_M	134_Y	1.648	1.00
122_V	154_D	1.602	1.00
102_E	105_E	1.590	1.00
128_I	156_Y	1.587	1.00
128_I	138_I	1.559	1.00
7_R	55_V	1.547	1.00
11_T	46_A	1.524	1.00
86_V	96_A	1.520	1.00
15_E	38_D	1.518	1.00
132_K	138_I	1.493	1.00
37_S	40_M	1.490	1.00
14_Y	42_Q	1.489	1.00
145_Y	155_A	1.481	1.00
114_D	152_Y	1.436	1.00
125_A	128_I	1.405	1.00
66_L	103_M	1.392	1.00
122_V	141_T	1.374	1.00
63_V	90_W	1.347	1.00
16_A	61_D	1.346	1.00
56_A	59_D	1.329	1.00
123_D	153_V	1.322	1.00
128_I	158_M	1.320	1.00
142_G	157_Y	1.318	1.00
106_M	111_L	1.317	1.00
106_M	110_W	1.292	1.00
97_S	130_V	1.280	1.00
5_V	57_C	1.278	1.00
97_S	101_R	1.264	1.00
97_S	134_Y	1.256	1.00
138_I	158_M	1.229	1.00
61_D	90_W	1.217	1.00
84_I	131_Y	1.207	1.00
107_C	116_I	1.176	1.00
65_H	85_C	1.174	1.00
61_D	89_R	1.173	1.00
16_A	19_Q	1.168	1.00
79_V	117_E	1.154	1.00
24_P	27_Y	1.148	1.00
11_T	42_Q	1.138	1.00
115_R	159_A	1.133	1.00
141_T	154_D	1.131	1.00
122_V	156_Y	1.115	1.00
42_Q	46_A	1.113	1.00
14_Y	45_L	1.102	1.00
143_K	159_A	1.094	1.00
20_I	85_C	1.086	1.00
50_G	54_L	1.081	1.00
19_Q	87_D	1.077	1.00
43_E	47_D	1.063	1.00
84_I	127_A	1.054	1.00
18_R	38_D	1.050	1.00
96_A	130_V	1.041	1.00
53_Q	57_C	1.032	1.00
54_L	57_C	1.030	1.00
144_K	154_D	1.029	1.00
81_D	119_T	1.019	1.00
130_V	134_Y	1.017	1.00
98_A	102_E	1.012	1.00
88_S	91_K	1.008	1.00
78_H	147_L	1.007	1.00
115_R	139_E	1.003	1.00
120_V	158_M	1.001	1.00
20_I	87_D	0.980	1.00
68_I	103_M	0.975	1.00
18_R	22_A	0.974	1.00
7_R	57_C	0.972	1.00
118_L	136_F	0.971	1.00
91_K	126_P	0.970	1.00
107_C	111_L	0.960	1.00
55_V	62_V	0.952	1.00
121_F	153_V	0.936	1.00
101_R	105_E	0.934	1.00
14_Y	38_D	0.933	1.00
101_R	134_Y	0.933	1.00
61_D	87_D	0.928	1.00
125_A	129_K	0.928	1.00
15_E	19_Q	0.920	1.00
104_I	134_Y	0.914	1.00
23_Q	87_D	0.908	1.00
39_H	42_Q	0.907	1.00
95_V	98_A	0.907	1.00
41_W	44_R	0.905	1.00
79_V	145_Y	0.897	1.00
131_Y	136_F	0.882	1.00
142_G	145_Y	0.882	1.00
86_V	95_V	0.878	1.00
53_Q	56_A	0.875	1.00
9_A	65_H	0.867	1.00
14_Y	18_R	0.863	1.00
16_A	87_D	0.862	1.00
58_I	63_V	0.859	1.00
55_V	60_G	0.851	1.00
25_E	28_C	0.841	1.00
90_W	93_R	0.840	1.00
147_L	151_E	0.836	1.00
23_Q	89_R	0.826	1.00
119_T	155_A	0.825	1.00
78_H	152_Y	0.822	1.00
127_A	131_Y	0.820	1.00
107_C	113_V	0.814	1.00
92_N	126_P	0.811	1.00
9_A	53_Q	0.811	1.00
84_I	96_A	0.808	1.00
19_Q	61_D	0.808	1.00
79_V	115_R	0.804	1.00
139_E	143_K	0.792	1.00
38_D	41_W	0.791	1.00
4_I	99_L	0.786	1.00
21_H	85_C	0.786	1.00
43_E	46_A	0.781	1.00
18_R	41_W	0.773	1.00
72_Q	77_S	0.769	1.00
102_E	106_M	0.767	1.00
5_V	60_G	0.763	1.00
11_T	14_Y	0.762	1.00
41_W	45_L	0.761	1.00
68_I	80_A	0.754	1.00
144_K	152_Y	0.754	1.00
33_V	36_P	0.753	1.00
52_K	56_A	0.752	1.00
125_A	132_K	0.742	1.00
20_I	62_V	0.733	1.00
120_V	127_A	0.724	1.00
137_E	143_K	0.716	1.00
100_M	130_V	0.716	1.00
119_T	142_G	0.715	1.00
48_R	51_I	0.712	1.00
4_I	102_E	0.711	1.00
25_E	91_K	0.709	1.00
132_K	158_M	0.706	1.00
81_D	117_E	0.705	1.00
29_N	121_F	0.700	1.00
4_I	95_V	0.700	1.00
19_Q	89_R	0.697	1.00
80_A	116_I	0.693	1.00
26_V	91_K	0.692	1.00
39_H	43_E	0.691	1.00
92_N	97_S	0.685	1.00
115_R	145_Y	0.683	1.00
4_I	98_A	0.680	1.00
123_D	151_E	0.672	1.00
52_K	55_V	0.669	1.00
119_T	157_Y	0.667	1.00
118_L	158_M	0.659	1.00
29_N	123_D	0.659	1.00
143_K	154_D	0.658	1.00
7_R	10_E	0.653	1.00
92_N	129_K	0.652	1.00
49_P	52_K	0.652	1.00
129_K	133_K	0.651	1.00
40_M	43_E	0.649	1.00
84_I	100_M	0.644	1.00
19_Q	23_Q	0.643	1.00
58_I	95_V	0.640	1.00
5_V	55_V	0.638	1.00
82_F	116_I	0.626	1.00
126_P	129_K	0.625	1.00
40_M	44_R	0.620	1.00
53_Q	62_V	0.617	1.00
27_Y	30_T	0.610	1.00
117_E	145_Y	0.601	1.00
117_E	142_G	0.601	1.00
57_C	60_G	0.601	1.00
50_G	56_A	0.599	1.00
118_L	127_A	0.597	1.00
97_S	126_P	0.597	1.00
10_E	13_D	0.596	1.00
54_L	58_I	0.589	1.00
9_A	17_I	0.588	1.00
70_V	80_A	0.581	1.00
148_R	151_E	0.579	1.00
23_Q	91_K	0.576	1.00
32_Q	35_H	0.574	1.00
37_S	41_W	0.572	1.00
78_H	114_D	0.572	1.00
80_A	107_C	0.571	1.00
6_I	102_E	0.567	1.00
148_R	153_V	0.566	1.00
50_G	53_Q	0.565	1.00
86_V	90_W	0.565	1.00
56_A	99_L	0.554	1.00
67_T	83_G	0.552	1.00
9_A	55_V	0.547	1.00
146_A	155_A	0.547	1.00
104_I	108_D	0.543	1.00
63_V	95_V	0.543	1.00
9_A	62_V	0.543	1.00
62_V	65_H	0.542	1.00
30_T	33_V	0.536	1.00
66_L	100_M	0.535	1.00
86_V	91_K	0.534	1.00
6_I	99_L	0.528	1.00
116_I	136_F	0.521	1.00
23_Q	26_V	0.520	1.00
55_V	58_I	0.519	1.00
147_L	150_G	0.518	1.00
17_I	65_H	0.517	1.00
100_M	116_I	0.515	1.00
84_I	130_V	0.514	1.00
15_E	18_R	0.514	1.00
53_Q	58_I	0.512	1.00
58_I	93_R	0.511	1.00
54_L	106_M	0.510	1.00
122_V	128_I	0.504	1.00
120_V	156_Y	0.503	1.00
56_A	95_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3r9fA	1	0.9877	100	0.26	Contact Map
2vzyA	3	0.8889	100	0.267	Contact Map
2fckA	2	0.9691	100	0.274	Contact Map
3pzjA	2	0.9815	100	0.28	Contact Map
1yreA	2	0.963	100	0.294	Contact Map
1nslA	3	0.9877	99.9	0.297	Contact Map
1s7kA	2	0.8889	99.9	0.298	Contact Map
3fbuA	2	0.9753	99.9	0.302	Contact Map
2z10A	2	0.9815	99.9	0.302	Contact Map
3tthA	5	0.9815	99.9	0.306	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.