YHBQ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YHBQ - UPF0213 protein YhbQ

UniProt:	P45472	Sequences: MTPWFLYLIRTADNKLYTGITTDVERRYQQHQSGKGAKALRGKGELTLVFSAPVGDRSLALRAEYRVKQLTKRQKERLVAEGAGFAELLSSLQTPEIKSD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12786
Length:	100 (80)
Sequences:	1866 (1432)
Seq/√Len:	160.1

ECOLI - YHBQ
BACSU - YAZA
HALSA - Y2274

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_D	59_L	2.471	1.00
26_R	30_Q	2.467	1.00
65_Y	69_Q	2.448	1.00
52_A	63_A	2.403	1.00
4_W	20_I	2.387	1.00
10_R	47_T	2.379	1.00
15_K	39_A	2.362	1.00
8_L	18_T	2.349	1.00
58_S	62_R	2.073	1.00
20_I	61_L	2.059	1.00
24_V	51_S	2.054	1.00
63_A	66_R	2.021	1.00
18_T	67_V	1.875	1.00
13_D	43_K	1.873	1.00
29_Q	33_S	1.873	1.00
16_L	76_E	1.762	1.00
6_L	67_V	1.719	1.00
71_T	74_Q	1.667	1.00
10_R	49_V	1.665	1.00
28_Y	32_Q	1.648	1.00
57_R	61_L	1.636	1.00
72_K	76_E	1.629	1.00
32_Q	46_L	1.513	1.00
10_R	14_N	1.503	1.00
8_L	67_V	1.418	1.00
28_Y	48_L	1.296	1.00
10_R	76_E	1.268	1.00
11_T	39_A	1.253	1.00
32_Q	44_G	1.146	1.00
58_S	61_L	1.128	1.00
54_V	63_A	1.118	1.00
70_L	74_Q	1.103	1.00
24_V	48_L	1.096	1.00
6_L	18_T	1.091	0.99
62_R	66_R	1.087	0.99
63_A	78_L	1.066	0.99
76_E	80_A	1.062	0.99
74_Q	77_R	1.061	0.99
9_I	28_Y	1.059	0.99
49_V	79_V	1.058	0.99
11_T	40_L	1.051	0.99
21_T	24_V	1.017	0.99
13_D	39_A	0.999	0.99
50_F	63_A	0.986	0.99
8_L	16_L	0.969	0.99
18_T	75_K	0.960	0.99
20_I	57_R	0.946	0.99
12_A	44_G	0.911	0.98
37_A	41_R	0.905	0.98
77_R	81_E	0.902	0.98
50_F	78_L	0.886	0.98
73_R	77_R	0.882	0.98
30_Q	44_G	0.862	0.97
67_V	78_L	0.856	0.97
66_R	70_L	0.852	0.97
28_Y	46_L	0.840	0.97
40_L	43_K	0.836	0.97
9_I	32_Q	0.820	0.96
68_K	75_K	0.777	0.95
30_Q	35_K	0.759	0.95
15_K	43_K	0.754	0.94
24_V	28_Y	0.730	0.93
40_L	46_L	0.720	0.93
34_G	44_G	0.707	0.92
6_L	54_V	0.697	0.92
38_K	41_R	0.683	0.91
12_A	32_Q	0.681	0.91
9_I	40_L	0.666	0.90
22_T	26_R	0.662	0.89
54_V	59_L	0.661	0.89
22_T	30_Q	0.660	0.89
4_W	57_R	0.660	0.89
10_R	16_L	0.654	0.89
52_A	78_L	0.653	0.89
11_T	45_E	0.651	0.89
61_L	68_K	0.649	0.89
11_T	15_K	0.645	0.88
5_F	51_S	0.642	0.88
9_I	46_L	0.638	0.88
16_L	49_V	0.635	0.87
16_L	79_V	0.633	0.87
5_F	53_P	0.628	0.87
32_Q	45_E	0.625	0.87
8_L	50_F	0.623	0.86
73_R	76_E	0.619	0.86
6_L	78_L	0.618	0.86
32_Q	43_K	0.603	0.85
80_A	83_A	0.601	0.84
20_I	30_Q	0.598	0.84
72_K	79_V	0.596	0.84
23_D	26_R	0.594	0.84
11_T	43_K	0.590	0.83
56_D	61_L	0.587	0.83
70_L	78_L	0.582	0.83
21_T	26_R	0.578	0.82
55_G	59_L	0.572	0.81
49_V	78_L	0.567	0.81
12_A	43_K	0.564	0.81
37_A	40_L	0.563	0.80
18_T	70_L	0.553	0.79
6_L	20_I	0.553	0.79
57_R	65_Y	0.552	0.79
30_Q	57_R	0.540	0.78
5_F	24_V	0.539	0.77
13_D	40_L	0.536	0.77
10_R	72_K	0.534	0.77
25_E	53_P	0.532	0.77
77_R	82_G	0.531	0.76
29_Q	73_R	0.527	0.76
39_A	42_G	0.527	0.76
4_W	22_T	0.525	0.76
4_W	61_L	0.521	0.75
65_Y	68_K	0.519	0.75
52_A	66_R	0.517	0.75
53_P	77_R	0.514	0.74
40_L	45_E	0.514	0.74
20_I	68_K	0.505	0.73
54_V	61_L	0.504	0.73
25_E	82_G	0.503	0.73
25_E	51_S	0.500	0.72

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zg2A	1	0.93	100	0.235	Contact Map
1ywlA	1	0.91	100	0.258	Contact Map
4xlgA	1	0.74	99.9	0.36	Contact Map
1mk0A	1	0.84	97.2	0.807	Contact Map
1yd0A	1	0.77	96.6	0.823	Contact Map
1yd6A	5	0.82	95.8	0.835	Contact Map
2wshA	4	0.77	57.5	0.902	Contact Map
4gbsA	1	0.37	21.7	0.923	Contact Map
4zcfA	2	0.73	20.4	0.924	Contact Map
3u22A	4	0.4	10.2	0.933	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.