FLGN - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLGN - Flagella synthesis protein FlgN

UniProt:	P43533	Sequences: MTRLAEILDQMSAVLNDLKTVMDQEQQHLSMGQINGSQLQWITEQKSSLLATLDYLEQLRRKEPNTANSVDISQRWQEITVKTQQLRQMNQHNGWLLEGQIERNQQALEMLKPHQEPTLYGANGQTSTTHRGGKKISI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12665
Length:	138 (127)
Sequences:	264 (191)
Seq/√Len:	17.0

ECOLI - FLGN

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_L	86_L	2.953	0.98
56_L	111_L	2.906	0.98
9_D	75_R	2.749	0.97
119_L	122_A	2.659	0.97
93_N	111_L	2.524	0.96
17_D	22_M	2.452	0.95
18_L	50_L	2.438	0.95
120_Y	124_G	2.209	0.91
94_G	111_L	2.205	0.91
117_P	122_A	2.048	0.88
11_M	64_P	2.023	0.87
11_M	86_L	1.989	0.86
32_G	107_A	1.938	0.85
11_M	53_L	1.836	0.81
68_N	78_E	1.820	0.81
79_I	86_L	1.797	0.80
11_M	79_I	1.794	0.80
29_L	96_L	1.769	0.79
89_M	104_N	1.722	0.77
34_I	101_I	1.713	0.77
64_P	97_L	1.687	0.75
85_Q	106_Q	1.642	0.73
13_A	133_G	1.635	0.73
81_V	102_E	1.598	0.71
13_A	81_V	1.467	0.64
88_Q	114_H	1.464	0.64
15_L	50_L	1.460	0.64
4_L	72_I	1.454	0.64
25_E	46_K	1.424	0.62
23_D	85_Q	1.393	0.60
18_L	99_G	1.389	0.60
95_W	109_E	1.372	0.59
6_E	27_Q	1.356	0.58
7_I	109_E	1.347	0.58
90_N	94_G	1.325	0.56
89_M	103_R	1.267	0.53
28_H	42_I	1.247	0.52
53_L	100_Q	1.247	0.52
38_Q	108_L	1.237	0.51
11_M	97_L	1.236	0.51
79_I	112_K	1.235	0.51
52_T	55_Y	1.229	0.51
95_W	98_E	1.220	0.50
107_A	113_P	1.219	0.50
19_K	53_L	1.217	0.50
5_A	103_R	1.212	0.50
18_L	97_L	1.197	0.49
25_E	124_G	1.186	0.48
25_E	120_Y	1.186	0.48
46_K	124_G	1.186	0.48
46_K	120_Y	1.186	0.48
16_N	82_K	1.169	0.47
28_H	82_K	1.147	0.46
11_M	57_E	1.145	0.46
103_R	125_Q	1.143	0.46
105_Q	110_M	1.142	0.46
50_L	64_P	1.123	0.44
63_E	91_Q	1.107	0.43
11_M	110_M	1.106	0.43
13_A	23_D	1.101	0.43
18_L	102_E	1.088	0.42
52_T	97_L	1.083	0.42
11_M	54_D	1.082	0.42
118_T	126_T	1.071	0.41
19_K	86_L	1.020	0.38
119_L	133_G	1.013	0.38
63_E	71_D	1.010	0.38
46_K	60_R	1.003	0.37
25_E	60_R	1.003	0.37
41_W	127_S	0.986	0.37
92_H	97_L	0.986	0.37
97_L	111_L	0.977	0.36
54_D	100_Q	0.972	0.36
104_N	125_Q	0.962	0.35
99_G	119_L	0.951	0.35
107_A	111_L	0.939	0.34
43_T	58_Q	0.932	0.34
8_L	96_L	0.927	0.33
91_Q	119_L	0.918	0.33
31_M	43_T	0.909	0.32
93_N	108_L	0.904	0.32
50_L	79_I	0.897	0.32
70_V	106_Q	0.894	0.32
80_T	122_A	0.892	0.31
50_L	57_E	0.886	0.31
18_L	40_Q	0.882	0.31
3_R	105_Q	0.881	0.31
26_Q	129_T	0.878	0.31
38_Q	83_T	0.877	0.31
96_L	122_A	0.876	0.31
42_I	59_L	0.873	0.31
55_Y	97_L	0.866	0.30
72_I	129_T	0.848	0.29
12_S	21_V	0.834	0.29
94_G	108_L	0.832	0.28
48_S	116_E	0.825	0.28
30_S	59_L	0.817	0.28
73_S	81_V	0.809	0.27
17_D	20_T	0.808	0.27
22_M	87_R	0.797	0.27
63_E	66_T	0.797	0.27
57_E	64_P	0.795	0.27
51_A	58_Q	0.794	0.27
41_W	114_H	0.792	0.27
35_N	89_M	0.781	0.26
46_K	76_W	0.781	0.26
25_E	76_W	0.781	0.26
46_K	90_N	0.780	0.26
25_E	90_N	0.780	0.26
35_N	61_R	0.778	0.26
29_L	104_N	0.778	0.26
13_A	85_Q	0.773	0.26
35_N	83_T	0.766	0.25
64_P	110_M	0.762	0.25
42_I	107_A	0.758	0.25
121_G	125_Q	0.757	0.25
80_T	123_N	0.756	0.25
8_L	24_Q	0.755	0.25
95_W	99_G	0.755	0.25
72_I	115_Q	0.754	0.25
60_R	120_Y	0.749	0.25
60_R	124_G	0.749	0.25
14_V	100_Q	0.747	0.25
62_K	77_Q	0.738	0.24
65_N	84_Q	0.736	0.24
83_T	86_L	0.733	0.24
10_Q	101_I	0.731	0.24
56_L	107_A	0.728	0.24
45_Q	78_E	0.715	0.23
7_I	101_I	0.715	0.23
78_E	85_Q	0.702	0.23
28_H	79_I	0.700	0.23
32_G	123_N	0.684	0.22
49_L	69_S	0.682	0.22
24_Q	100_Q	0.671	0.21
57_E	112_K	0.671	0.21
73_S	78_E	0.663	0.21
52_T	74_Q	0.661	0.21
16_N	45_Q	0.656	0.21
31_M	106_Q	0.654	0.21
59_L	82_K	0.640	0.20
88_Q	105_Q	0.638	0.20
92_H	113_P	0.637	0.20
12_S	47_S	0.637	0.20
82_K	133_G	0.631	0.20
59_L	62_K	0.626	0.20
4_L	57_E	0.624	0.20
9_D	85_Q	0.618	0.19
56_L	108_L	0.618	0.19
87_R	111_L	0.618	0.19
14_V	56_L	0.617	0.19
35_N	70_V	0.606	0.19
18_L	76_W	0.605	0.19
45_Q	129_T	0.601	0.19
32_G	94_G	0.590	0.18
92_H	107_A	0.585	0.18
30_S	119_L	0.583	0.18
34_I	100_Q	0.581	0.18
100_Q	106_Q	0.579	0.18
58_Q	133_G	0.577	0.18
57_E	85_Q	0.575	0.18
22_M	60_R	0.568	0.17
44_E	103_R	0.568	0.17
40_Q	64_P	0.567	0.17
10_Q	40_Q	0.563	0.17
84_Q	107_A	0.550	0.17
22_M	94_G	0.548	0.17
62_K	78_E	0.548	0.17
20_T	23_D	0.545	0.17
10_Q	42_I	0.544	0.17
64_P	117_P	0.543	0.17
75_R	110_M	0.543	0.17
73_S	77_Q	0.537	0.16
24_Q	42_I	0.533	0.16
54_D	79_I	0.532	0.16
24_Q	45_Q	0.530	0.16
90_N	124_G	0.527	0.16
90_N	120_Y	0.527	0.16
24_Q	77_Q	0.525	0.16
51_A	77_Q	0.520	0.16
111_L	119_L	0.517	0.16
65_N	109_E	0.516	0.16
92_H	99_G	0.515	0.16
29_L	46_K	0.513	0.16
25_E	29_L	0.513	0.16
13_A	41_W	0.511	0.16
94_G	107_A	0.502	0.15
76_W	124_G	0.502	0.15
76_W	120_Y	0.502	0.15
102_E	125_Q	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3opcA	2	0.8116	99.9	0.42	Contact Map
2fupA	1	0.7826	99.9	0.447	Contact Map
2hh7A	3	0.5	7.8	0.937	Contact Map
4kblA	2	0.5072	6.2	0.94	Contact Map
2ycuA	1	0.4565	4.3	0.944	Contact Map
3t98A	4	0.2319	4.1	0.945	Contact Map
3itfA	2	0.6594	4.1	0.945	Contact Map
2v2fA	1	0.1087	4	0.945	Contact Map
4j3hA	4	0.2319	3.7	0.946	Contact Map
1qvrA	3	0.9783	3.6	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.