PTPB1 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTPB1 - N-acetylgalactosamine-specific phosphotransferase enzyme IIB component 1

UniProt:	P42909	Sequences: MTSPNILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETYGFGIRFFTIEKTINVIGKAAPHQKIFLICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQISSKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQIPD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12769
Length:	158 (149)
Sequences:	1621 (1106)
Seq/√Len:	90.6

ECOLI - PTPB1 PTPB2 PTNAB
BACSU - PTFB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_D	91_T	4.295	1.00
97_E	135_F	3.893	1.00
70_I	98_G	2.912	1.00
104_D	142_N	2.847	1.00
93_R	97_E	2.631	1.00
92_V	105_V	2.625	1.00
127_D	131_T	2.538	1.00
93_R	135_F	2.465	1.00
97_E	139_R	2.461	1.00
67_E	71_N	2.425	1.00
86_C	92_V	2.323	1.00
93_R	132_D	2.220	1.00
117_K	130_L	2.150	1.00
38_D	94_K	2.063	1.00
142_N	153_K	2.000	1.00
66_I	94_K	1.997	1.00
96_V	136_I	1.925	1.00
119_I	125_V	1.917	1.00
67_E	94_K	1.885	1.00
86_C	95_L	1.842	1.00
30_A	83_F	1.837	1.00
90_Q	132_D	1.773	1.00
25_T	59_F	1.733	1.00
117_K	127_D	1.725	1.00
7_L	81_K	1.687	1.00
54_A	61_I	1.676	1.00
29_G	81_K	1.667	1.00
46_Q	87_R	1.666	1.00
131_T	135_F	1.658	1.00
90_Q	128_Q	1.636	1.00
11_I	133_L	1.585	1.00
37_D	87_R	1.579	1.00
41_A	65_T	1.542	1.00
113_S	116_K	1.468	1.00
118_Q	124_Y	1.434	0.99
107_V	133_L	1.426	0.99
135_F	138_Q	1.418	0.99
104_D	153_K	1.410	0.99
25_T	33_L	1.405	0.99
96_V	102_L	1.398	0.99
11_I	107_V	1.394	0.99
13_N	109_N	1.369	0.99
9_T	92_V	1.346	0.99
44_D	47_Q	1.342	0.99
89_P	110_M	1.336	0.99
104_D	144_F	1.318	0.99
11_I	89_P	1.317	0.99
32_L	62_R	1.295	0.99
7_L	28_I	1.277	0.99
109_N	122_K	1.262	0.99
89_P	132_D	1.257	0.98
135_F	139_R	1.218	0.98
64_F	72_V	1.174	0.98
67_E	98_G	1.168	0.98
142_N	155_Q	1.167	0.98
137_K	143_V	1.155	0.97
126_D	129_D	1.152	0.97
43_D	46_Q	1.143	0.97
134_R	138_Q	1.140	0.97
146_Q	149_P	1.137	0.97
13_N	111_H	1.132	0.97
94_K	98_G	1.124	0.97
23_T	149_P	1.122	0.97
116_K	126_D	1.120	0.97
94_K	97_E	1.090	0.96
128_Q	131_T	1.088	0.96
89_P	133_L	1.083	0.96
133_L	143_V	1.080	0.96
23_T	150_G	1.080	0.96
36_V	69_T	1.062	0.96
32_L	80_Q	1.056	0.96
16_V	61_I	1.040	0.95
68_K	71_N	1.037	0.95
16_V	50_M	1.033	0.95
66_I	91_T	0.990	0.94
16_V	35_V	0.988	0.94
107_V	145_I	0.978	0.93
90_Q	94_K	0.977	0.93
39_V	43_D	0.976	0.93
93_R	139_R	0.952	0.92
128_Q	132_D	0.945	0.92
9_T	102_L	0.940	0.92
110_M	125_V	0.936	0.92
110_M	133_L	0.935	0.92
38_D	66_I	0.919	0.91
118_Q	121_S	0.919	0.91
13_N	16_V	0.918	0.91
72_V	75_K	0.917	0.91
146_Q	153_K	0.915	0.91
9_T	86_C	0.912	0.91
7_L	30_A	0.908	0.90
88_T	91_T	0.902	0.90
31_N	81_K	0.899	0.90
112_F	115_G	0.899	0.90
42_N	65_T	0.892	0.90
36_V	91_T	0.888	0.89
70_I	74_G	0.880	0.89
64_F	75_K	0.879	0.89
120_S	123_V	0.878	0.89
9_T	84_L	0.863	0.88
122_K	147_D	0.858	0.88
21_G	25_T	0.841	0.87
110_M	123_V	0.840	0.87
8_L	83_F	0.837	0.86
65_T	68_K	0.832	0.86
96_V	139_R	0.831	0.86
71_N	74_G	0.825	0.86
112_F	124_Y	0.816	0.85
34_V	72_V	0.810	0.85
40_V	46_Q	0.805	0.84
91_T	94_K	0.800	0.84
33_L	54_A	0.791	0.83
48_K	52_I	0.781	0.82
73_I	101_D	0.778	0.82
46_Q	50_M	0.778	0.82
83_F	151_D	0.776	0.82
116_K	129_D	0.754	0.80
111_H	116_K	0.752	0.80
23_T	27_T	0.751	0.80
47_Q	63_F	0.746	0.79
38_D	65_T	0.739	0.79
107_V	143_V	0.734	0.78
26_S	85_I	0.734	0.78
144_F	153_K	0.731	0.78
26_S	58_G	0.728	0.78
15_L	85_I	0.726	0.78
71_N	75_K	0.721	0.77
31_N	80_Q	0.720	0.77
96_V	105_V	0.714	0.76
8_L	28_I	0.710	0.76
103_K	142_N	0.709	0.76
38_D	91_T	0.708	0.76
137_K	155_Q	0.702	0.75
132_D	135_F	0.700	0.75
73_I	95_L	0.689	0.74
125_V	133_L	0.686	0.74
45_I	49_L	0.685	0.73
34_V	86_C	0.682	0.73
32_L	82_I	0.681	0.73
123_V	145_I	0.679	0.73
121_S	151_D	0.677	0.73
70_I	94_K	0.675	0.72
64_F	77_A	0.671	0.72
131_T	134_R	0.669	0.72
47_Q	51_G	0.669	0.72
72_V	76_A	0.665	0.71
21_G	53_T	0.664	0.71
101_D	139_R	0.662	0.71
40_V	106_N	0.660	0.71
74_G	98_G	0.658	0.70
18_G	108_G	0.657	0.70
62_R	77_A	0.657	0.70
64_F	68_K	0.654	0.70
62_R	72_V	0.654	0.70
36_V	95_L	0.642	0.69
40_V	50_M	0.640	0.68
66_I	98_G	0.639	0.68
81_K	145_I	0.638	0.68
96_V	141_V	0.626	0.67
85_I	124_Y	0.626	0.67
39_V	87_R	0.624	0.66
36_V	66_I	0.621	0.66
42_N	85_I	0.615	0.65
51_G	61_I	0.614	0.65
84_L	92_V	0.613	0.65
51_G	63_F	0.612	0.65
33_L	85_I	0.611	0.65
111_H	122_K	0.609	0.64
68_K	72_V	0.596	0.63
105_V	141_V	0.594	0.63
7_L	29_G	0.594	0.63
109_N	147_D	0.592	0.62
65_T	95_L	0.591	0.62
70_I	102_L	0.588	0.62
115_G	126_D	0.588	0.62
116_K	124_Y	0.582	0.61
13_N	87_R	0.582	0.61
67_E	70_I	0.580	0.61
34_V	76_A	0.578	0.60
20_V	25_T	0.575	0.60
39_V	44_D	0.574	0.60
19_Q	109_N	0.574	0.60
73_I	76_A	0.573	0.60
59_F	83_F	0.568	0.59
35_V	85_I	0.568	0.59
16_V	30_A	0.567	0.59
146_Q	151_D	0.561	0.58
53_T	56_T	0.560	0.58
39_V	46_Q	0.558	0.58
11_I	32_L	0.557	0.58
125_V	130_L	0.552	0.57
102_L	133_L	0.551	0.57
69_T	82_I	0.551	0.57
31_N	98_G	0.548	0.56
131_T	138_Q	0.547	0.56
27_T	150_G	0.546	0.56
22_V	124_Y	0.545	0.56
26_S	30_A	0.543	0.56
32_L	69_T	0.542	0.56
69_T	73_I	0.541	0.55
26_S	29_G	0.536	0.55
76_A	82_I	0.534	0.55
95_L	100_I	0.531	0.54
64_F	76_A	0.528	0.54
16_V	109_N	0.528	0.54
8_L	22_V	0.526	0.53
120_S	145_I	0.524	0.53
110_M	124_Y	0.524	0.53
56_T	85_I	0.522	0.53
34_V	69_T	0.521	0.53
21_G	50_M	0.520	0.53
13_N	110_M	0.518	0.52
56_T	59_F	0.515	0.52
85_I	116_K	0.515	0.52
36_V	70_I	0.513	0.52
130_L	134_R	0.505	0.51
32_L	64_F	0.505	0.51
72_V	77_A	0.504	0.50
62_R	80_Q	0.504	0.50
70_I	100_I	0.503	0.50
16_V	54_A	0.502	0.50
112_F	118_Q	0.502	0.50
69_T	72_V	0.501	0.50
89_P	93_R	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3eyeA	1	0.962	100	0.049	Contact Map
1bleA	3	0.9747	100	0.062	Contact Map
3lfjA	1	0.9937	100	0.063	Contact Map
1nrzA	2	0.9747	100	0.064	Contact Map
1vsqC	1	0.9937	100	0.07	Contact Map
3p3vA	1	0.9873	100	0.079	Contact Map
3co8A	2	0.8228	34.6	0.935	Contact Map
2wk1A	2	0.481	18.2	0.943	Contact Map
2yggA	1	0.2342	16.2	0.944	Contact Map
3hl4A	2	0.5063	14.8	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.