PTPC2 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTPC2 - Putative N-acetylgalactosamine permease IIC component 2

UniProt:	P42905	Sequences: MEISLLQAFALGIIAFIAGLDMFNGLTHMHRPVVLGPLVGLVLGDLHTGILTGGTLELVWMGLAPLAGAQPPNVIIGTIVGTAFAITTGVKPDVAVGVAVPFAVAVQMGITFLFSVMSGVMSRCDLATNPRRI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12765
Length:	133 (128)
Sequences:	1200 (659)
Seq/√Len:	58.2

ECOLI - PTPC2 PTNC PTPC1
BACSU - PTFC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_D	48_T	5.206	1.00
14_I	38_L	3.673	1.00
123_R	126_L	3.590	1.00
31_R	57_E	3.549	1.00
41_L	46_L	2.975	1.00
36_G	49_G	2.843	1.00
14_I	42_V	2.722	1.00
126_L	130_P	2.707	1.00
8_A	12_G	2.667	1.00
122_S	125_D	2.475	1.00
127_A	132_R	2.213	1.00
123_R	127_A	2.201	1.00
76_I	106_V	2.150	1.00
38_L	42_V	2.146	1.00
11_L	39_V	2.043	1.00
126_L	129_N	2.010	1.00
85_A	95_A	1.995	1.00
47_H	51_L	1.978	1.00
128_T	131_R	1.778	0.99
37_P	46_L	1.751	0.99
55_T	59_V	1.706	0.99
48_T	86_I	1.691	0.99
43_L	87_T	1.662	0.99
5_L	9_F	1.637	0.99
94_V	97_G	1.630	0.99
127_A	130_P	1.618	0.99
48_T	52_T	1.613	0.99
6_L	10_A	1.602	0.99
17_I	29_M	1.494	0.98
33_V	37_P	1.438	0.97
10_A	42_V	1.418	0.97
128_T	132_R	1.416	0.97
77_G	103_A	1.355	0.96
6_L	9_F	1.341	0.96
124_C	128_T	1.310	0.95
21_D	72_P	1.270	0.94
73_N	76_I	1.258	0.94
77_G	83_A	1.247	0.94
69_A	114_F	1.244	0.94
7_Q	87_T	1.233	0.93
43_L	86_I	1.222	0.93
51_L	54_G	1.212	0.93
98_V	102_F	1.199	0.92
72_P	103_A	1.186	0.92
125_D	129_N	1.152	0.91
14_I	35_L	1.144	0.91
110_I	114_F	1.119	0.90
49_G	53_G	1.080	0.88
50_I	53_G	1.076	0.88
51_L	84_F	1.069	0.87
48_T	51_L	1.067	0.87
73_N	110_I	1.053	0.86
39_V	83_A	1.050	0.86
61_M	104_V	1.038	0.86
11_L	42_V	1.030	0.85
11_L	79_I	1.024	0.85
120_V	123_R	1.009	0.84
31_R	34_V	0.999	0.83
25_G	31_R	0.998	0.83
15_A	79_I	0.996	0.83
35_L	78_T	0.992	0.83
59_V	81_G	0.990	0.83
104_V	108_M	0.971	0.82
47_H	50_I	0.966	0.81
18_A	35_L	0.962	0.81
90_V	94_V	0.961	0.81
104_V	107_Q	0.954	0.81
80_V	102_F	0.936	0.79
10_A	13_I	0.929	0.79
107_Q	111_T	0.898	0.76
36_G	82_T	0.895	0.76
62_G	127_A	0.882	0.75
129_N	132_R	0.868	0.74
33_V	36_G	0.866	0.74
60_W	77_G	0.864	0.73
33_V	54_G	0.857	0.73
85_A	91_K	0.848	0.72
7_Q	42_V	0.841	0.71
35_L	79_I	0.838	0.71
62_G	101_P	0.836	0.71
56_L	77_G	0.830	0.70
40_G	53_G	0.826	0.70
80_V	84_F	0.821	0.70
28_H	78_T	0.819	0.69
80_V	83_A	0.817	0.69
34_V	37_P	0.810	0.69
14_I	79_I	0.809	0.68
7_Q	10_A	0.779	0.66
101_P	104_V	0.775	0.65
91_K	94_V	0.765	0.64
118_S	121_M	0.756	0.63
61_M	78_T	0.748	0.62
36_G	78_T	0.745	0.62
5_L	8_A	0.742	0.62
99_A	104_V	0.740	0.62
14_I	18_A	0.739	0.61
74_V	81_G	0.735	0.61
87_T	93_D	0.729	0.60
61_M	75_I	0.728	0.60
12_G	118_S	0.728	0.60
17_I	20_L	0.714	0.59
56_L	78_T	0.712	0.59
36_G	68_G	0.707	0.58
122_S	126_L	0.705	0.58
23_F	114_F	0.702	0.58
101_P	105_A	0.695	0.57
119_G	123_R	0.695	0.57
108_M	111_T	0.687	0.56
19_G	96_V	0.685	0.56
90_V	122_S	0.684	0.56
78_T	99_A	0.684	0.56
111_T	115_S	0.683	0.55
108_M	112_F	0.683	0.55
20_L	73_N	0.682	0.55
31_R	84_F	0.676	0.55
84_F	87_T	0.675	0.55
66_L	70_Q	0.675	0.55
77_G	84_F	0.675	0.55
88_T	130_P	0.674	0.54
97_G	100_V	0.673	0.54
68_G	72_P	0.672	0.54
70_Q	74_V	0.670	0.54
51_L	58_L	0.664	0.53
36_G	43_L	0.663	0.53
107_Q	110_I	0.662	0.53
77_G	81_G	0.658	0.53
98_V	104_V	0.656	0.52
61_M	73_N	0.651	0.52
21_D	100_V	0.651	0.52
62_G	100_V	0.648	0.52
46_L	50_I	0.638	0.50
82_T	86_I	0.637	0.50
49_G	83_A	0.626	0.49
58_L	72_P	0.620	0.49
50_I	55_T	0.620	0.49
18_A	75_I	0.615	0.48
65_P	70_Q	0.614	0.48
32_P	96_V	0.612	0.48
49_G	66_L	0.607	0.47
74_V	77_G	0.606	0.47
89_G	116_V	0.604	0.47
85_A	92_P	0.598	0.46
55_T	96_V	0.596	0.46
48_T	78_T	0.595	0.46
81_G	85_A	0.589	0.45
7_Q	43_L	0.588	0.45
18_A	30_H	0.584	0.45
7_Q	11_L	0.575	0.44
11_L	43_L	0.573	0.43
91_K	130_P	0.570	0.43
64_A	106_V	0.569	0.43
76_I	94_V	0.567	0.43
25_G	95_A	0.566	0.43
80_V	104_V	0.563	0.42
78_T	108_M	0.558	0.42
41_L	128_T	0.555	0.41
106_V	117_M	0.553	0.41
6_L	126_L	0.551	0.41
37_P	116_V	0.551	0.41
68_G	85_A	0.548	0.41
60_W	67_A	0.545	0.40
12_G	83_A	0.544	0.40
88_T	99_A	0.541	0.40
82_T	120_V	0.540	0.40
9_F	12_G	0.540	0.40
76_I	99_A	0.539	0.40
63_L	79_I	0.538	0.40
54_G	74_V	0.537	0.39
30_H	39_V	0.536	0.39
56_L	76_I	0.536	0.39
58_L	61_M	0.535	0.39
115_S	118_S	0.535	0.39
79_I	83_A	0.534	0.39
58_L	102_F	0.530	0.39
9_F	44_G	0.529	0.39
18_A	96_V	0.528	0.39
116_V	131_R	0.526	0.38
16_F	98_V	0.523	0.38
73_N	107_Q	0.523	0.38
92_P	98_V	0.522	0.38
10_A	92_P	0.521	0.38
38_L	49_G	0.521	0.38
89_G	93_D	0.519	0.38
86_I	91_K	0.518	0.37
52_T	82_T	0.514	0.37
39_V	86_I	0.513	0.37
96_V	109_G	0.510	0.37
15_A	107_Q	0.508	0.36
74_V	95_A	0.507	0.36
21_D	59_V	0.506	0.36
9_F	47_H	0.501	0.36
78_T	82_T	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1orqC	4	0.7068	1.5	0.959	Contact Map
3qnqA	2	0.8346	1.5	0.959	Contact Map
4pevA	1	0.2556	1.1	0.963	Contact Map
1jb0M	1	0.2331	1.1	0.963	Contact Map
4lh9A	4	0.2331	1	0.964	Contact Map
4qoyE	1	0.1203	1	0.964	Contact Map
2eq8C	1	0.1128	1	0.964	Contact Map
2eq9C	1	0.1203	1	0.964	Contact Map
1ji6A	1	0.3759	0.9	0.966	Contact Map
4ru1A	2	0.2707	0.8	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.