PTPB2 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTPB2 - N-acetylgalactosamine-specific phosphotransferase enzyme IIB component 2

UniProt:	P42904	Sequences: MPNIVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDPVQQNLMEMVLAEGIAVRFWTLQKVIDNIHRAADRQKILLVCKTPADFLTLVKGGVPVNRINVGNMHYANGKQQIAKTVSVDAGDIAAFNDLKTAGVECFVQGVPTEPAVDLFKLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12764
Length:	157 (151)
Sequences:	1625 (1097)
Seq/√Len:	89.3

ECOLI - PTPB2 PTPB1 PTNAB
BACSU - PTFB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_N	88_D	4.408	1.00
94_K	132_D	3.903	1.00
67_I	95_G	2.933	1.00
101_R	139_E	2.832	1.00
89_F	102_I	2.698	1.00
124_A	128_A	2.611	1.00
90_L	94_K	2.607	1.00
90_L	132_D	2.504	1.00
64_Q	68_D	2.488	1.00
94_K	136_A	2.396	1.00
83_C	89_F	2.353	1.00
90_L	129_A	2.212	1.00
36_D	91_T	2.144	1.00
114_Q	127_I	2.109	1.00
63_L	91_T	2.043	1.00
139_E	150_A	1.983	1.00
116_I	122_V	1.935	1.00
52_L	58_V	1.909	1.00
93_V	133_L	1.897	1.00
64_Q	91_T	1.873	1.00
83_C	92_L	1.868	1.00
28_A	80_L	1.832	1.00
87_A	129_A	1.792	1.00
5_V	78_K	1.768	1.00
44_Q	84_K	1.726	1.00
27_G	78_K	1.710	1.00
23_V	56_I	1.694	1.00
87_A	125_G	1.688	1.00
114_Q	124_A	1.659	1.00
128_A	132_D	1.638	1.00
35_N	84_K	1.612	1.00
39_A	62_T	1.540	1.00
9_I	130_F	1.535	1.00
132_D	135_T	1.461	0.99
110_A	113_K	1.460	0.99
115_Q	121_S	1.439	0.99
101_R	150_A	1.412	0.99
93_V	99_V	1.405	0.99
42_P	45_Q	1.383	0.99
23_V	31_V	1.376	0.99
104_V	130_F	1.373	0.99
11_E	106_N	1.367	0.99
139_E	152_D	1.353	0.99
9_I	104_V	1.345	0.99
9_I	86_P	1.341	0.99
101_R	141_F	1.327	0.99
7_S	89_F	1.319	0.99
86_P	107_M	1.319	0.99
30_L	59_R	1.309	0.99
106_N	119_T	1.297	0.99
86_P	129_A	1.257	0.98
134_K	154_F	1.256	0.98
5_V	26_A	1.242	0.98
132_D	136_A	1.218	0.98
61_W	69_N	1.188	0.98
123_D	126_D	1.188	0.98
64_Q	95_G	1.186	0.98
143_Q	146_P	1.162	0.97
125_G	128_A	1.162	0.97
11_E	108_H	1.139	0.97
21_Q	146_P	1.133	0.97
41_D	44_Q	1.128	0.97
131_N	135_T	1.108	0.96
134_K	140_C	1.104	0.96
113_K	123_D	1.095	0.96
91_T	95_G	1.087	0.96
86_P	130_F	1.068	0.96
30_L	77_Q	1.067	0.96
143_Q	150_A	1.057	0.95
130_F	140_C	1.051	0.95
21_Q	147_T	1.042	0.95
14_I	58_V	1.037	0.95
91_T	94_K	1.033	0.95
34_A	66_V	1.030	0.95
14_I	48_M	1.026	0.95
65_K	68_D	1.022	0.94
87_A	91_T	0.980	0.93
63_L	88_D	0.978	0.93
104_V	142_V	0.966	0.93
37_E	41_D	0.965	0.93
14_I	33_V	0.963	0.92
7_S	99_V	0.944	0.92
11_E	14_I	0.938	0.91
107_M	122_V	0.933	0.91
90_L	136_A	0.932	0.91
115_Q	118_K	0.918	0.91
7_S	83_C	0.917	0.91
34_A	88_D	0.917	0.91
85_T	88_D	0.913	0.90
69_N	72_R	0.906	0.90
107_M	130_F	0.902	0.90
5_V	28_A	0.898	0.90
67_I	71_H	0.893	0.89
29_N	78_K	0.888	0.89
125_G	129_A	0.886	0.89
61_W	72_R	0.884	0.89
119_T	144_G	0.877	0.88
36_D	63_L	0.877	0.88
7_S	81_L	0.873	0.88
40_E	62_T	0.868	0.88
109_Y	112_G	0.850	0.87
62_T	65_K	0.849	0.87
117_A	120_V	0.839	0.86
19_G	23_V	0.833	0.86
107_M	120_V	0.831	0.86
38_V	44_Q	0.828	0.85
109_Y	121_S	0.826	0.85
68_D	71_H	0.812	0.84
6_L	80_L	0.810	0.84
93_V	136_A	0.794	0.83
46_N	50_M	0.794	0.83
31_V	52_L	0.787	0.82
88_D	91_T	0.783	0.82
32_L	69_N	0.781	0.82
14_I	52_L	0.770	0.81
70_I	98_P	0.763	0.80
108_H	113_K	0.763	0.80
100_N	139_E	0.763	0.80
21_Q	25_F	0.752	0.79
45_Q	60_F	0.750	0.79
36_D	62_T	0.743	0.79
141_F	150_A	0.736	0.78
44_Q	48_M	0.736	0.78
104_V	140_C	0.733	0.78
80_L	148_E	0.731	0.78
24_G	55_G	0.724	0.77
13_L	82_V	0.722	0.77
134_K	152_D	0.711	0.76
113_K	126_D	0.711	0.76
68_D	72_R	0.706	0.75
6_L	26_A	0.706	0.75
130_F	153_L	0.704	0.75
69_N	73_A	0.699	0.74
129_A	132_D	0.696	0.74
70_I	92_L	0.694	0.74
38_V	48_M	0.693	0.74
24_G	82_V	0.692	0.74
29_N	77_Q	0.690	0.73
32_L	83_C	0.684	0.73
47_L	52_L	0.673	0.72
30_L	79_I	0.671	0.71
71_H	95_G	0.669	0.71
43_V	47_L	0.666	0.71
67_I	91_T	0.664	0.71
19_G	51_V	0.660	0.70
118_K	148_E	0.659	0.70
59_R	74_A	0.656	0.70
38_V	103_N	0.655	0.69
36_D	88_D	0.652	0.69
45_Q	49_E	0.652	0.69
120_V	142_V	0.651	0.69
31_V	82_V	0.650	0.69
63_L	95_G	0.649	0.69
61_W	65_K	0.647	0.69
16_G	105_G	0.644	0.68
128_A	131_N	0.639	0.68
49_E	58_V	0.638	0.67
122_V	130_F	0.633	0.67
93_V	102_I	0.632	0.67
59_R	69_N	0.620	0.65
34_A	63_L	0.619	0.65
34_A	92_L	0.618	0.65
49_E	60_F	0.617	0.65
82_V	121_S	0.615	0.65
93_V	138_V	0.614	0.65
64_Q	67_I	0.609	0.64
37_E	84_K	0.608	0.64
98_P	136_A	0.607	0.64
78_K	142_V	0.607	0.64
40_E	82_V	0.595	0.62
102_I	138_V	0.589	0.61
11_E	84_K	0.589	0.61
65_K	69_N	0.584	0.61
113_K	121_S	0.583	0.61
106_N	144_G	0.581	0.60
20_V	121_S	0.579	0.60
122_V	154_F	0.579	0.60
62_T	92_L	0.578	0.60
108_H	119_T	0.577	0.60
14_I	28_A	0.576	0.60
56_I	80_L	0.574	0.59
70_I	73_A	0.572	0.59
24_G	28_A	0.570	0.59
17_Q	106_N	0.569	0.59
81_L	89_F	0.566	0.58
5_V	27_G	0.563	0.58
67_I	99_V	0.562	0.58
37_E	42_P	0.562	0.58
125_G	154_F	0.560	0.57
142_V	153_L	0.556	0.57
82_V	153_L	0.555	0.57
122_V	127_I	0.553	0.57
66_V	70_I	0.551	0.56
18_V	23_V	0.547	0.56
128_A	135_T	0.544	0.55
52_L	56_I	0.543	0.55
9_I	30_L	0.542	0.55
37_E	44_Q	0.541	0.55
19_G	53_A	0.540	0.55
99_V	130_F	0.540	0.55
11_E	107_M	0.539	0.55
25_F	147_T	0.537	0.54
73_A	79_I	0.536	0.54
61_W	74_A	0.533	0.54
24_G	27_G	0.532	0.54
140_C	154_F	0.532	0.54
92_L	97_V	0.531	0.54
64_Q	154_F	0.531	0.54
117_A	142_V	0.530	0.53
30_L	75_D	0.527	0.53
66_V	79_I	0.525	0.53
69_N	74_A	0.524	0.53
104_V	153_L	0.521	0.52
112_G	123_D	0.519	0.52
6_L	20_V	0.519	0.52
143_Q	148_E	0.517	0.52
32_L	73_A	0.515	0.51
30_L	66_V	0.513	0.51
14_I	106_N	0.512	0.51
83_C	86_P	0.505	0.50
33_V	82_V	0.504	0.50
27_G	87_A	0.504	0.50
14_I	82_V	0.502	0.50
19_G	48_M	0.502	0.50
33_V	58_V	0.501	0.49
107_M	121_S	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lfjA	1	1	100	0.035	Contact Map
1bleA	3	0.9936	100	0.042	Contact Map
1nrzA	2	0.9936	100	0.047	Contact Map
1vsqC	1	0.9936	100	0.048	Contact Map
3eyeA	1	0.9682	100	0.055	Contact Map
3p3vA	1	0.9936	100	0.061	Contact Map
3co8A	2	0.8344	40.3	0.932	Contact Map
3hl4A	2	0.4968	28.8	0.937	Contact Map
2wk1A	2	0.4713	25.1	0.939	Contact Map
4eclA	2	0.828	17.3	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.