KPTA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

KPTA - RNA 2'-phosphotransferase

UniProt:	P39380	Sequences: MAKYNEKELADTSKFLSFVLRHKPEAIGIVLDREGWADIDKLILCAQKAGKRLTRALLDTVVATSDKKRFSYSSDGRCIRAVQGHSTSQVAISFAEKTPPQFLYHGTASRFLDEIKKQGLIAGERHYVHLSADEATARKVGARHGSPVILTVKAQEMAKRGLPFWQAENGVWLTSTVAVEFLEW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12570
Length:	184 (174)
Sequences:	1154 (850)
Seq/√Len:	64.5

ECOLI - KPTA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
160_R	181_F	4.061	1.00
71_S	82_V	3.953	1.00
9_L	60_T	3.702	1.00
39_I	72_Y	3.252	1.00
108_A	144_H	3.208	1.00
55_R	59_D	3.071	1.00
31_L	37_A	2.764	1.00
54_T	57_L	2.757	1.00
18_F	23_K	2.746	1.00
39_I	58_L	2.738	1.00
153_K	156_E	2.696	1.00
155_Q	159_K	2.595	1.00
118_Q	121_I	2.541	1.00
60_T	64_T	2.529	1.00
65_S	68_K	2.459	1.00
101_Q	155_Q	2.312	1.00
82_V	167_A	2.143	1.00
108_A	111_F	2.073	1.00
16_L	42_L	2.002	1.00
112_L	150_L	1.945	1.00
10_A	14_K	1.933	1.00
23_K	26_A	1.914	1.00
65_S	70_F	1.868	1.00
38_D	41_K	1.826	1.00
59_D	72_Y	1.804	1.00
152_V	182_L	1.758	1.00
18_F	26_A	1.734	0.99
13_S	70_F	1.720	0.99
160_R	180_E	1.712	0.99
157_M	164_F	1.667	0.99
19_V	27_I	1.658	0.99
150_L	182_L	1.645	0.99
127_Y	165_W	1.632	0.99
59_D	63_A	1.590	0.99
83_Q	169_N	1.585	0.99
68_K	82_V	1.578	0.99
43_I	53_L	1.554	0.99
17_S	70_F	1.550	0.99
120_L	176_T	1.532	0.99
122_A	175_S	1.508	0.99
98_T	101_Q	1.504	0.99
162_L	178_A	1.497	0.98
114_E	118_Q	1.497	0.98
96_E	163_P	1.495	0.98
103_L	130_L	1.469	0.98
156_E	160_R	1.446	0.98
71_S	168_E	1.430	0.98
13_S	17_S	1.378	0.97
34_E	93_S	1.367	0.97
8_E	57_L	1.361	0.97
86_S	124_E	1.349	0.97
73_S	77_R	1.320	0.97
152_V	164_F	1.316	0.97
12_T	51_K	1.274	0.96
112_L	116_K	1.268	0.96
156_E	159_K	1.256	0.95
55_R	77_R	1.253	0.95
141_G	145_G	1.235	0.95
73_S	76_G	1.221	0.95
92_I	127_Y	1.204	0.94
99_P	164_F	1.192	0.94
105_H	115_I	1.190	0.94
177_V	180_E	1.187	0.94
102_F	153_K	1.173	0.94
16_L	61_V	1.159	0.93
37_A	42_L	1.157	0.93
99_P	172_W	1.139	0.92
12_T	53_L	1.116	0.92
133_D	136_T	1.113	0.92
82_V	168_E	1.083	0.90
66_D	144_H	1.080	0.90
139_K	142_A	1.077	0.90
15_F	46_A	1.068	0.90
63_A	68_K	1.066	0.90
163_P	175_S	1.063	0.90
43_I	58_L	1.029	0.88
46_A	53_L	1.022	0.88
101_Q	153_K	1.013	0.87
57_L	60_T	1.012	0.87
58_L	72_Y	1.005	0.87
15_F	19_V	1.000	0.87
174_T	177_V	0.995	0.86
164_F	172_W	0.993	0.86
61_V	70_F	0.992	0.86
108_A	146_S	0.990	0.86
134_E	151_T	0.986	0.86
105_H	125_R	0.978	0.85
122_A	127_Y	0.961	0.84
130_L	152_V	0.955	0.84
32_D	78_C	0.950	0.84
130_L	174_T	0.943	0.83
100_P	172_W	0.926	0.82
120_L	141_G	0.919	0.82
90_V	94_F	0.917	0.81
62_V	65_S	0.913	0.81
62_V	67_K	0.906	0.81
157_M	177_V	0.893	0.80
132_A	166_Q	0.883	0.79
166_Q	172_W	0.871	0.78
36_W	71_S	0.869	0.78
10_A	40_D	0.867	0.78
39_I	55_R	0.866	0.78
102_F	151_T	0.863	0.77
83_Q	167_A	0.860	0.77
43_I	57_L	0.859	0.77
121_I	128_V	0.849	0.76
107_T	143_R	0.848	0.76
29_I	37_A	0.848	0.76
138_R	149_I	0.842	0.76
10_A	96_E	0.840	0.75
15_F	27_I	0.831	0.75
62_V	79_I	0.830	0.74
72_Y	77_R	0.827	0.74
30_V	41_K	0.826	0.74
114_E	123_G	0.826	0.74
92_I	130_L	0.822	0.74
40_D	55_R	0.816	0.73
120_L	182_L	0.805	0.72
103_L	172_W	0.788	0.71
105_H	123_G	0.784	0.70
41_K	45_C	0.782	0.70
135_A	138_R	0.780	0.70
154_A	158_A	0.778	0.70
104_Y	133_D	0.771	0.69
103_L	154_A	0.768	0.69
100_P	103_L	0.767	0.69
53_L	58_L	0.756	0.67
64_T	68_K	0.753	0.67
161_G	164_F	0.753	0.67
169_N	173_L	0.753	0.67
29_I	45_C	0.753	0.67
94_F	126_H	0.751	0.67
31_L	87_T	0.744	0.66
144_H	149_I	0.744	0.66
94_F	167_A	0.743	0.66
37_A	41_K	0.740	0.66
95_A	98_T	0.737	0.65
45_C	48_K	0.736	0.65
55_R	58_L	0.735	0.65
116_K	150_L	0.730	0.65
156_E	175_S	0.728	0.64
134_E	182_L	0.725	0.64
43_I	46_A	0.724	0.64
9_L	53_L	0.722	0.64
176_T	180_E	0.722	0.64
27_I	45_C	0.720	0.64
141_G	171_V	0.719	0.63
62_V	169_N	0.716	0.63
127_Y	167_A	0.709	0.62
13_S	61_V	0.708	0.62
38_D	77_R	0.702	0.62
70_F	127_Y	0.696	0.61
156_E	181_F	0.695	0.61
136_T	172_W	0.694	0.61
108_A	147_P	0.682	0.59
37_A	45_C	0.681	0.59
25_E	30_V	0.681	0.59
19_V	42_L	0.679	0.59
126_H	167_A	0.674	0.59
166_Q	170_G	0.671	0.58
131_S	136_T	0.668	0.58
8_E	11_D	0.668	0.58
45_C	49_A	0.662	0.57
39_I	76_G	0.658	0.57
112_L	148_V	0.656	0.56
127_Y	175_S	0.652	0.56
108_A	112_L	0.652	0.56
115_I	143_R	0.650	0.56
107_T	115_I	0.648	0.56
82_V	94_F	0.647	0.55
90_V	126_H	0.640	0.55
29_I	46_A	0.639	0.55
73_S	110_R	0.637	0.54
131_S	149_I	0.632	0.54
29_I	117_K	0.632	0.54
47_Q	176_T	0.631	0.54
29_I	41_K	0.629	0.53
60_T	63_A	0.627	0.53
106_G	140_V	0.626	0.53
138_R	142_A	0.625	0.53
128_V	162_L	0.624	0.53
12_T	57_L	0.622	0.53
72_Y	82_V	0.620	0.52
96_E	166_Q	0.620	0.52
56_A	59_D	0.620	0.52
120_L	143_R	0.618	0.52
136_T	140_V	0.615	0.52
83_Q	171_V	0.615	0.52
125_R	143_R	0.613	0.51
98_T	158_A	0.602	0.50
114_E	121_I	0.602	0.50
105_H	143_R	0.600	0.50
19_V	45_C	0.597	0.50
174_T	182_L	0.597	0.50
71_S	167_A	0.597	0.50
92_I	126_H	0.596	0.50
61_V	65_S	0.591	0.49
42_L	103_L	0.591	0.49
14_K	18_F	0.587	0.48
157_M	172_W	0.586	0.48
104_Y	149_I	0.581	0.48
40_D	44_L	0.580	0.48
38_D	78_C	0.574	0.47
31_L	90_V	0.571	0.47
88_S	118_Q	0.571	0.47
106_G	125_R	0.570	0.46
84_G	143_R	0.569	0.46
83_Q	170_G	0.568	0.46
100_P	130_L	0.567	0.46
133_D	142_A	0.566	0.46
44_L	98_T	0.566	0.46
167_A	170_G	0.565	0.46
18_F	25_E	0.563	0.46
16_L	46_A	0.562	0.46
167_A	173_L	0.561	0.45
14_K	27_I	0.557	0.45
73_S	78_C	0.556	0.45
58_L	136_T	0.556	0.45
25_E	28_G	0.556	0.45
34_E	92_I	0.555	0.45
94_F	173_L	0.551	0.44
8_E	15_F	0.550	0.44
116_K	121_I	0.549	0.44
56_A	148_V	0.548	0.44
121_I	179_V	0.547	0.44
165_W	173_L	0.546	0.44
62_V	171_V	0.545	0.44
12_T	50_G	0.542	0.43
59_D	77_R	0.540	0.43
34_E	91_A	0.540	0.43
131_S	140_V	0.539	0.43
110_R	114_E	0.538	0.43
33_R	87_T	0.535	0.42
66_D	70_F	0.533	0.42
10_A	66_D	0.533	0.42
109_S	112_L	0.532	0.42
131_S	144_H	0.532	0.42
111_F	114_E	0.532	0.42
83_Q	127_Y	0.531	0.42
8_E	19_V	0.531	0.42
68_K	71_S	0.531	0.42
92_I	168_E	0.530	0.42
65_S	127_Y	0.528	0.42
68_K	79_I	0.526	0.41
11_D	34_E	0.525	0.41
54_T	180_E	0.523	0.41
145_G	157_M	0.522	0.41
13_S	105_H	0.522	0.41
47_Q	50_G	0.521	0.41
55_R	76_G	0.519	0.41
117_K	155_Q	0.518	0.41
106_G	115_I	0.516	0.40
164_F	169_N	0.515	0.40
97_K	100_P	0.515	0.40
16_L	58_L	0.514	0.40
132_A	138_R	0.507	0.39
66_D	139_K	0.504	0.39
97_K	166_Q	0.503	0.39
62_V	145_G	0.501	0.39
142_A	148_V	0.501	0.39
9_L	64_T	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1wfxA	3	0.9348	100	0.111	Contact Map
4f0dA	1	0.75	90.4	0.923	Contact Map
2cqkA	1	0.4511	85.9	0.929	Contact Map
1efyA	1	0.8261	84.5	0.93	Contact Map
3smjA	2	0.788	84	0.93	Contact Map
3kjdA	1	0.8261	81.1	0.933	Contact Map
3bljA	1	0.8315	79.9	0.933	Contact Map
2pqfA	2	0.7935	79	0.934	Contact Map
3hkvA	2	0.7717	79	0.934	Contact Map
2mtfA	1	0.4728	75.5	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.