INSN2 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

INSN2 - Transposase InsN for insertion sequence element IS911B

UniProt:	P39212	Sequences: MICSPQNNTGAPMKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRKLRKKLQRIEMENEILKRLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG40014
Length:	100 (87)
Sequences:	579 (373)
Seq/√Len:	39.9

ECOLI - INSN2 INSN1 YKGN INSJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
78_E	83_R	6.146	1.00
85_K	90_E	4.442	1.00
86_L	89_I	3.869	1.00
78_E	81_K	2.488	1.00
89_I	93_N	2.420	1.00
71_P	80_R	2.195	0.99
36_T	39_D	2.171	0.99
26_S	51_M	1.970	0.99
35_Y	40_A	1.968	0.99
28_Q	32_D	1.656	0.96
52_T	56_K	1.521	0.94
79_I	82_L	1.500	0.93
27_A	58_L	1.488	0.93
53_R	57_Q	1.453	0.92
79_I	83_R	1.445	0.92
18_F	23_K	1.437	0.92
27_A	55_V	1.436	0.92
69_A	73_T	1.405	0.91
88_R	92_E	1.333	0.89
81_K	85_K	1.310	0.88
37_V	52_T	1.300	0.87
91_M	94_E	1.295	0.87
85_K	88_R	1.294	0.87
32_D	62_R	1.257	0.85
26_S	44_M	1.255	0.85
42_K	45_D	1.218	0.84
78_E	86_L	1.208	0.83
72_I	75_E	1.208	0.83
67_P	73_T	1.193	0.82
75_E	79_I	1.173	0.81
29_L	44_M	1.153	0.80
71_P	77_I	1.142	0.79
29_L	40_A	1.139	0.79
90_E	94_E	1.127	0.79
35_Y	59_R	1.126	0.78
30_V	40_A	1.120	0.78
82_L	86_L	1.112	0.78
48_L	52_T	1.094	0.76
39_D	43_A	1.085	0.76
38_A	42_K	1.083	0.76
27_A	62_R	1.067	0.75
47_G	50_T	1.065	0.74
87_Q	94_E	1.004	0.70
87_Q	91_M	1.002	0.70
14_K	17_N	1.000	0.70
61_E	64_G	0.987	0.69
29_L	35_Y	0.973	0.68
69_A	77_I	0.970	0.67
51_M	54_W	0.969	0.67
20_A	24_R	0.936	0.64
28_Q	80_R	0.911	0.62
69_A	72_I	0.910	0.62
29_L	33_Q	0.901	0.61
50_T	53_R	0.895	0.61
58_L	62_R	0.856	0.58
67_P	71_P	0.855	0.57
73_T	76_Q	0.848	0.57
31_V	62_R	0.847	0.57
21_E	51_M	0.844	0.56
67_P	80_R	0.842	0.56
37_V	48_L	0.820	0.54
30_V	96_L	0.804	0.53
46_V	55_V	0.801	0.53
89_I	92_E	0.799	0.52
64_G	73_T	0.780	0.51
86_L	93_N	0.779	0.51
47_G	57_Q	0.779	0.51
67_P	75_E	0.773	0.50
18_F	22_F	0.768	0.50
61_E	65_K	0.755	0.48
25_E	29_L	0.752	0.48
49_S	57_Q	0.750	0.48
42_K	56_K	0.748	0.48
66_T	71_P	0.740	0.47
70_S	77_I	0.723	0.45
30_V	41_A	0.719	0.45
76_Q	79_I	0.711	0.44
86_L	90_E	0.707	0.44
14_K	94_E	0.691	0.43
19_S	25_E	0.684	0.42
20_A	70_S	0.680	0.42
87_Q	90_E	0.678	0.41
76_Q	96_L	0.677	0.41
26_S	52_T	0.670	0.41
33_Q	40_A	0.668	0.40
70_S	74_P	0.662	0.40
13_M	45_D	0.661	0.40
40_A	46_V	0.655	0.39
18_F	50_T	0.649	0.39
77_I	81_K	0.640	0.38
45_D	65_K	0.636	0.38
71_P	75_E	0.633	0.37
66_T	70_S	0.620	0.36
22_F	26_S	0.620	0.36
66_T	80_R	0.618	0.36
38_A	49_S	0.608	0.35
60_D	65_K	0.599	0.35
58_L	81_K	0.595	0.34
56_K	60_D	0.592	0.34
62_R	65_K	0.590	0.34
27_A	31_V	0.590	0.34
67_P	74_P	0.585	0.33
73_T	80_R	0.583	0.33
72_I	77_I	0.572	0.32
20_A	33_Q	0.570	0.32
38_A	52_T	0.565	0.32
57_Q	62_R	0.564	0.32
91_M	95_I	0.563	0.32
44_M	51_M	0.559	0.31
72_I	76_Q	0.551	0.31
47_G	53_R	0.549	0.31
25_E	31_V	0.548	0.30
24_R	73_T	0.548	0.30
19_S	28_Q	0.545	0.30
37_V	53_R	0.544	0.30
42_K	48_L	0.534	0.29
36_T	49_S	0.534	0.29
39_D	87_Q	0.533	0.29
54_W	97_K	0.531	0.29
17_N	87_Q	0.525	0.29
28_Q	43_A	0.524	0.29
79_I	94_E	0.522	0.28
92_E	96_L	0.521	0.28
17_N	56_K	0.521	0.28
71_P	76_Q	0.519	0.28
69_A	74_P	0.516	0.28
51_M	93_N	0.515	0.28
67_P	92_E	0.514	0.28
23_K	70_S	0.504	0.27
34_K	81_K	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2rn7A	1	0.87	99.8	0.443	Contact Map
2jn6A	1	0.88	99.8	0.466	Contact Map
1hlvA	1	0.88	99	0.656	Contact Map
2oa4A	1	0.85	98.9	0.669	Contact Map
2ao9A	7	0.66	98.8	0.681	Contact Map
2gloA	1	0.56	98.7	0.691	Contact Map
2k27A	1	0.98	98.6	0.708	Contact Map
2jrtA	1	0.8	98.5	0.712	Contact Map
2elhA	1	0.82	98.5	0.713	Contact Map
1u78A	1	0.81	98.5	0.718	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.