USPG - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

USPG - Universal stress protein G

UniProt:	P39177	Sequences: MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSASLSLHRFAADVRRFEEHLQHEAQERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12683
Length:	142 (130)
Sequences:	20074 (16285)
Seq/√Len:	1428.2

ECOLI - USPG USPF USPE USPD USPA USPC
BACSU - YXIE NHAX
HALSA - Q9HRP5 Q9HP90 Q9HPF7 Q9HPQ8 Q9HPP5 Q9HNX9 Q9HRD8 Q9HHX5 Q9HHV8 Q9HMI9 Q9HMJ0 Q9HHY0 Q9HMU1
SULSO - Q97X90 Q97V57 Q7LXW4 Q97U40

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_H	87_H	3.075	1.00
6_I	106_A	2.745	1.00
4_T	35_H	2.705	1.00
94_R	129_S	2.629	1.00
33_V	85_K	2.593	1.00
23_H	139_L	2.523	1.00
4_T	33_V	2.411	1.00
87_H	100_L	2.342	1.00
108_V	139_L	2.308	1.00
91_G	96_E	2.112	1.00
74_V	86_Q	2.009	1.00
35_H	85_K	1.961	1.00
111_I	130_V	1.938	1.00
109_V	136_L	1.938	1.00
35_H	106_A	1.926	1.00
89_R	96_E	1.849	1.00
128_S	132_R	1.810	1.00
33_V	83_R	1.760	1.00
35_H	100_L	1.752	1.00
8_P	111_I	1.727	1.00
7_M	24_A	1.723	1.00
101_A	109_V	1.713	1.00
22_R	76_H	1.708	1.00
4_T	107_D	1.679	1.00
39_V	96_E	1.648	1.00
37_L	100_L	1.623	1.00
74_V	78_T	1.579	1.00
96_E	99_E	1.536	1.00
8_P	97_V	1.501	1.00
102_E	135_N	1.464	1.00
109_V	134_A	1.456	1.00
63_Q	67_Q	1.413	1.00
27_L	30_D	1.408	1.00
38_H	66_A	1.386	1.00
18_D	76_H	1.365	1.00
7_M	21_V	1.342	1.00
24_A	28_A	1.341	1.00
89_R	100_L	1.332	1.00
67_Q	71_Q	1.315	1.00
32_G	107_D	1.315	1.00
98_N	133_H	1.313	1.00
129_S	133_H	1.301	1.00
101_A	135_N	1.268	1.00
93_V	126_N	1.259	1.00
109_V	130_V	1.222	1.00
71_Q	74_V	1.187	1.00
134_A	138_V	1.177	1.00
37_L	89_R	1.168	1.00
59_E	63_Q	1.164	1.00
100_L	106_A	1.128	1.00
118_I	122_L	1.091	1.00
39_V	93_V	1.084	1.00
73_M	77_F	1.079	1.00
69_R	73_M	1.060	1.00
4_T	106_A	1.059	1.00
113_S	140_V	1.057	1.00
111_I	127_A	1.037	1.00
11_V	38_H	1.035	1.00
17_S	20_A	1.029	1.00
64_H	68_E	1.026	1.00
5_I	108_V	1.007	1.00
101_A	136_L	1.005	1.00
18_D	72_T	1.003	1.00
71_Q	75_S	0.987	1.00
62_L	65_E	0.981	1.00
29_Q	80_D	0.945	1.00
30_D	107_D	0.941	1.00
69_R	72_T	0.937	1.00
37_L	97_V	0.936	1.00
101_A	106_A	0.924	1.00
120_T	128_S	0.921	1.00
60_E	64_H	0.921	1.00
66_A	70_L	0.916	1.00
98_N	101_A	0.915	1.00
9_V	73_M	0.915	1.00
36_L	84_I	0.911	1.00
65_E	69_R	0.911	1.00
25_E	82_S	0.911	1.00
12_F	17_S	0.902	1.00
21_V	73_M	0.902	1.00
131_I	140_V	0.901	1.00
23_H	26_F	0.899	1.00
23_H	27_L	0.897	1.00
21_V	36_L	0.897	1.00
66_A	88_V	0.890	1.00
71_Q	86_Q	0.885	1.00
40_L	90_F	0.884	1.00
70_L	86_Q	0.883	1.00
66_A	69_R	0.868	1.00
113_S	127_A	0.868	1.00
24_A	34_I	0.858	1.00
28_A	34_I	0.841	1.00
40_L	88_V	0.839	1.00
8_P	112_G	0.837	1.00
72_T	76_H	0.831	1.00
76_H	79_I	0.827	1.00
98_N	134_A	0.825	1.00
9_V	36_L	0.825	1.00
72_T	75_S	0.824	1.00
62_L	66_A	0.821	1.00
23_H	137_P	0.815	1.00
24_A	110_V	0.815	1.00
7_M	34_I	0.805	1.00
18_D	22_R	0.805	1.00
25_E	77_F	0.804	1.00
6_I	100_L	0.797	1.00
73_M	76_H	0.796	1.00
117_S	120_T	0.787	1.00
23_H	141_V	0.787	1.00
9_V	20_A	0.776	1.00
92_S	95_D	0.776	1.00
38_H	69_R	0.774	1.00
98_N	130_V	0.771	1.00
127_A	140_V	0.769	1.00
39_V	91_G	0.768	1.00
6_I	37_L	0.767	1.00
19_K	22_R	0.766	1.00
9_V	21_V	0.763	1.00
6_I	109_V	0.761	1.00
65_E	68_E	0.761	1.00
110_V	139_L	0.756	1.00
36_L	73_M	0.748	1.00
57_R	60_E	0.745	1.00
75_S	79_I	0.745	1.00
75_S	78_T	0.740	1.00
21_V	25_E	0.736	1.00
94_R	126_N	0.728	1.00
56_R	60_E	0.725	1.00
29_Q	81_P	0.718	1.00
28_A	32_G	0.715	1.00
9_V	18_D	0.715	1.00
61_H	64_H	0.713	1.00
96_E	100_L	0.712	1.00
105_G	136_L	0.708	1.00
117_S	121_H	0.707	1.00
97_V	130_V	0.705	1.00
91_G	99_E	0.698	1.00
68_E	72_T	0.697	1.00
111_I	140_V	0.696	1.00
25_E	80_D	0.680	1.00
25_E	29_Q	0.679	1.00
7_M	20_A	0.673	1.00
61_H	65_E	0.659	1.00
36_L	77_F	0.659	1.00
60_E	63_Q	0.659	1.00
67_Q	86_Q	0.649	1.00
77_F	84_I	0.643	1.00
94_R	98_N	0.641	1.00
123_L	127_A	0.640	1.00
56_R	59_E	0.635	1.00
118_I	121_H	0.632	1.00
70_L	74_V	0.632	1.00
64_H	67_Q	0.630	1.00
40_L	66_A	0.629	1.00
113_S	122_L	0.628	1.00
9_V	17_S	0.625	1.00
74_V	77_F	0.625	1.00
24_A	32_G	0.624	1.00
11_V	69_R	0.615	1.00
59_E	90_F	0.610	1.00
94_R	130_V	0.609	1.00
14_M	19_K	0.606	1.00
110_V	141_V	0.605	1.00
5_I	28_A	0.604	1.00
57_R	61_H	0.600	1.00
11_V	73_M	0.599	1.00
26_F	29_Q	0.595	1.00
68_E	71_Q	0.594	1.00
74_V	84_I	0.587	1.00
55_V	58_F	0.586	1.00
5_I	110_V	0.580	1.00
95_D	99_E	0.569	1.00
18_D	73_M	0.569	1.00
37_L	96_E	0.565	1.00
63_Q	90_F	0.564	1.00
102_E	136_L	0.558	1.00
130_V	138_V	0.558	1.00
20_A	110_V	0.554	1.00
27_L	139_L	0.549	1.00
13_E	18_D	0.547	1.00
112_G	141_V	0.544	1.00
114_R	127_A	0.543	1.00
76_H	80_D	0.537	1.00
27_L	110_V	0.537	1.00
98_N	129_S	0.530	1.00
97_V	126_N	0.529	1.00
10_D	17_S	0.529	1.00
94_R	133_H	0.527	1.00
131_I	138_V	0.525	1.00
44_A	47_S	0.525	1.00
58_F	61_H	0.520	1.00
25_E	76_H	0.516	1.00
39_V	89_R	0.507	1.00
27_L	32_G	0.501	1.00
36_L	86_Q	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
5ahwA	4	0.9859	99.9	0.154	Contact Map
3hgmA	2	0.9789	99.9	0.168	Contact Map
3s3tA	4	0.9789	99.9	0.169	Contact Map
1mjhA	2	0.9437	99.9	0.178	Contact Map
2gm3A	2	0.8662	99.9	0.179	Contact Map
4wnyA	2	0.8803	99.9	0.18	Contact Map
1tq8A	4	0.8451	99.9	0.187	Contact Map
2dumA	2	0.9507	99.9	0.19	Contact Map
3fg9A	3	0.9648	99.9	0.195	Contact Map
3fdxA	2	0.8873	99.9	0.207	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.