USPF - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

USPF - Universal stress protein F

UniProt:	P37903	Sequences: MNRTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPAMDDLKAEAKSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPAHMIIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12674
Length:	144 (132)
Sequences:	19871 (16008)
Seq/√Len:	1393.3

ECOLI - USPF USPG USPE USPD USPC USPA
BACSU - YXIE NHAX
HALSA - Q9HP90 Q9HRP5 Q9HPP5 Q9HPQ8 Q9HPF7 Q9HHX5 Q9HRD8 Q9HNX9 Q9HMJ0 Q9HHV8 Q9HMI9 Q9HHY0 Q9HMU1
SULSO - Q97X90 Q97V57 Q7LXW4 Q97U40

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_H	89_H	3.138	1.00
6_L	108_A	2.825	1.00
96_K	131_A	2.706	1.00
4_T	36_H	2.699	1.00
34_E	87_H	2.550	1.00
23_H	141_L	2.540	1.00
4_T	34_E	2.404	1.00
89_H	102_L	2.297	1.00
110_M	141_L	2.287	1.00
36_H	87_H	1.968	1.00
113_I	132_V	1.940	1.00
111_I	138_C	1.934	1.00
93_G	98_R	1.923	1.00
76_I	88_V	1.923	1.00
36_H	108_A	1.876	1.00
130_A	134_R	1.847	1.00
91_E	98_R	1.840	1.00
34_E	85_R	1.764	1.00
36_H	102_L	1.760	1.00
103_A	111_I	1.751	1.00
8_P	113_I	1.669	1.00
7_V	24_V	1.669	1.00
40_V	98_R	1.657	1.00
38_L	102_L	1.655	1.00
22_S	78_K	1.583	1.00
8_P	99_I	1.522	1.00
39_T	68_A	1.518	1.00
98_R	101_E	1.512	1.00
76_I	80_K	1.502	1.00
104_K	137_E	1.448	1.00
111_I	136_A	1.419	1.00
27_E	31_D	1.419	1.00
65_K	69_K	1.369	1.00
91_E	102_L	1.369	1.00
69_K	73_E	1.347	1.00
33_A	109_H	1.346	1.00
100_L	135_H	1.344	1.00
18_Q	78_K	1.338	1.00
7_V	21_I	1.324	1.00
131_A	135_H	1.318	1.00
103_A	137_E	1.284	1.00
4_T	109_H	1.263	1.00
24_V	28_A	1.237	1.00
111_I	132_V	1.217	1.00
38_L	91_E	1.194	1.00
95_P	128_N	1.180	1.00
40_V	95_P	1.160	1.00
120_I	124_L	1.159	1.00
102_L	108_A	1.111	1.00
78_K	81_L	1.109	1.00
9_I	75_I	1.099	1.00
73_E	88_V	1.096	1.00
73_E	76_I	1.096	1.00
136_A	140_V	1.094	1.00
115_S	142_V	1.044	1.00
103_A	138_C	1.039	1.00
4_T	108_A	1.037	1.00
5_I	110_M	1.031	1.00
11_I	39_T	1.028	1.00
26_E	30_I	1.022	1.00
41_I	92_E	1.011	1.00
113_I	129_A	1.009	1.00
73_E	77_K	1.004	1.00
71_Q	75_I	0.995	1.00
29_K	82_P	0.994	1.00
23_H	27_E	0.990	1.00
17_T	20_V	0.985	1.00
100_L	103_A	0.977	1.00
103_A	108_A	0.960	1.00
18_Q	74_E	0.959	1.00
61_M	65_K	0.957	1.00
62_D	66_A	0.950	1.00
39_T	71_Q	0.942	1.00
122_T	130_A	0.940	1.00
37_F	86_V	0.938	1.00
72_L	88_V	0.937	1.00
133_V	142_V	0.932	1.00
21_I	37_F	0.922	1.00
38_L	99_I	0.919	1.00
120_I	123_Y	0.918	1.00
71_Q	74_E	0.906	1.00
28_A	35_V	0.892	1.00
66_A	70_S	0.890	1.00
75_I	79_F	0.886	1.00
23_H	26_E	0.883	1.00
31_D	109_H	0.882	1.00
115_S	129_A	0.869	1.00
25_E	79_F	0.862	1.00
75_I	78_K	0.856	1.00
9_I	37_F	0.854	1.00
37_F	75_I	0.854	1.00
23_H	139_S	0.853	1.00
68_A	71_Q	0.853	1.00
24_V	112_I	0.852	1.00
24_V	35_V	0.852	1.00
21_I	75_I	0.848	1.00
12_S	17_T	0.842	1.00
129_A	142_V	0.838	1.00
6_L	102_L	0.825	1.00
100_L	132_V	0.825	1.00
9_I	20_V	0.825	1.00
100_L	136_A	0.822	1.00
64_L	67_E	0.821	1.00
8_P	114_A	0.811	1.00
68_A	90_V	0.808	1.00
41_I	90_V	0.807	1.00
68_A	72_L	0.807	1.00
118_P	121_T	0.806	1.00
6_L	38_L	0.806	1.00
94_S	97_D	0.805	1.00
56_A	59_P	0.797	1.00
25_E	84_D	0.794	1.00
77_K	81_L	0.777	1.00
77_K	80_K	0.770	1.00
67_E	70_S	0.768	1.00
23_H	143_V	0.766	1.00
54_Y	57_E	0.765	1.00
25_E	82_P	0.762	1.00
9_I	21_I	0.761	1.00
18_Q	22_S	0.757	1.00
29_K	83_T	0.757	1.00
63_D	66_A	0.751	1.00
21_I	25_E	0.750	1.00
99_I	132_V	0.749	1.00
19_R	22_S	0.746	1.00
96_K	128_N	0.744	1.00
117_R	125_L	0.744	1.00
112_I	141_L	0.744	1.00
6_L	111_I	0.733	1.00
41_I	68_A	0.733	1.00
74_E	78_K	0.733	1.00
24_V	33_A	0.732	1.00
74_E	77_K	0.731	1.00
28_A	33_A	0.730	1.00
9_I	18_Q	0.724	1.00
7_V	35_V	0.721	1.00
12_S	117_R	0.720	1.00
107_P	138_C	0.707	1.00
79_F	86_V	0.700	1.00
98_R	102_L	0.700	1.00
58_L	62_D	0.698	1.00
65_K	92_E	0.696	1.00
67_E	71_Q	0.695	1.00
66_A	69_K	0.689	1.00
125_L	129_A	0.688	1.00
18_Q	75_I	0.682	1.00
37_F	79_F	0.678	1.00
70_S	74_E	0.676	1.00
57_E	60_A	0.675	1.00
11_I	71_Q	0.675	1.00
27_E	30_I	0.674	1.00
28_A	31_D	0.672	1.00
59_P	63_D	0.665	1.00
60_A	63_D	0.658	1.00
11_I	75_I	0.654	1.00
69_K	88_V	0.651	1.00
55_S	59_P	0.649	1.00
76_I	86_V	0.648	1.00
40_V	93_G	0.642	1.00
5_I	28_A	0.642	1.00
113_I	142_V	0.637	1.00
26_E	29_K	0.636	1.00
112_I	143_V	0.635	1.00
63_D	67_E	0.634	1.00
72_L	90_V	0.627	1.00
9_I	17_T	0.627	1.00
38_L	98_R	0.626	1.00
62_D	65_K	0.619	1.00
5_I	112_I	0.619	1.00
7_V	20_V	0.611	1.00
25_E	29_K	0.606	1.00
64_L	68_A	0.598	1.00
59_P	62_D	0.593	1.00
14_S	19_R	0.588	1.00
104_K	138_C	0.587	1.00
115_S	124_L	0.585	1.00
133_V	140_V	0.582	1.00
96_K	100_L	0.582	1.00
61_M	92_E	0.579	1.00
10_D	17_T	0.579	1.00
27_E	112_I	0.573	1.00
89_H	92_E	0.572	1.00
96_K	132_V	0.561	1.00
58_L	61_M	0.560	1.00
97_D	101_E	0.558	1.00
70_S	73_E	0.549	1.00
132_V	140_V	0.549	1.00
20_V	112_I	0.548	1.00
116_H	129_A	0.548	1.00
72_L	76_I	0.541	1.00
45_P	48_A	0.539	1.00
25_E	78_K	0.537	1.00
69_K	90_V	0.521	1.00
114_A	143_V	0.520	1.00
27_E	141_L	0.514	1.00
43_S	92_E	0.509	1.00
78_K	82_P	0.501	1.00
57_E	61_M	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3hgmA	2	0.9792	99.9	0.146	Contact Map
3s3tA	4	0.9722	99.9	0.147	Contact Map
1mjhA	2	0.9444	99.9	0.15	Contact Map
5ahwA	4	0.9792	99.9	0.154	Contact Map
4wnyA	2	0.875	99.9	0.155	Contact Map
2dumA	2	0.9514	99.9	0.161	Contact Map
2gm3A	2	0.8681	99.9	0.164	Contact Map
3fg9A	3	0.9583	99.9	0.168	Contact Map
3fdxA	2	0.8819	99.9	0.175	Contact Map
4r2kA	2	0.9861	99.9	0.181	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.