ACPT - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ACPT - 4'-phosphopantetheinyl transferase AcpT

UniProt:	P37623	Sequences: MYRIVLGKVSTLSAAPLPPGLREQAPQGPRRERWLAGRALLSHTLSPLPEIIYGEQGKPAFAPEMPLWFNLSHSGDDIALLLSDEGEVGCDIEVIRPRANWRWLANAVFSLGEHAEMDAVHPDQQLEMFWRIWTRKEAIVKQRGGSAWQIVSVDSTYHSSLSVSHCQLENLSLAICTPTPFTLTADSVQWIDSVN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12221
Length:	195 (167)
Sequences:	1950 (1656)
Seq/√Len:	128.2

ECOLI - ACPT YIEE
BACSU - SFP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
110_S	154_D	3.043	1.00
27_Q	30_R	2.906	1.00
79_A	90_C	2.899	1.00
68_W	87_E	2.895	1.00
81_L	88_V	2.843	1.00
135_R	155_S	2.666	1.00
142_Q	161_L	2.537	1.00
58_K	68_W	2.469	1.00
52_I	60_A	2.419	1.00
18_P	38_R	2.417	1.00
79_A	173_L	2.295	1.00
112_G	154_D	2.169	1.00
113_E	136_K	2.159	1.00
140_V	150_I	2.146	1.00
22_R	34_W	2.050	1.00
135_R	163_V	2.028	1.00
25_A	30_R	1.943	1.00
22_R	35_L	1.941	1.00
93_E	134_T	1.934	1.00
30_R	33_R	1.890	1.00
105_A	114_H	1.885	1.00
11_T	23_E	1.866	1.00
44_T	80_L	1.840	1.00
45_L	69_F	1.821	1.00
140_V	145_G	1.794	1.00
81_L	90_C	1.785	1.00
34_W	38_R	1.784	1.00
105_A	108_V	1.713	1.00
18_P	34_W	1.699	1.00
44_T	82_L	1.685	1.00
120_V	128_M	1.683	1.00
74_S	93_E	1.635	1.00
147_A	150_I	1.621	1.00
122_P	125_Q	1.615	1.00
140_V	148_W	1.615	1.00
29_P	33_R	1.606	1.00
21_L	34_W	1.602	1.00
58_K	87_E	1.578	1.00
126_L	130_W	1.570	1.00
33_R	76_D	1.536	1.00
116_E	132_I	1.510	1.00
49_P	52_I	1.501	1.00
135_R	165_H	1.498	1.00
52_I	62_A	1.489	1.00
20_G	24_Q	1.478	1.00
40_L	78_I	1.456	1.00
106_N	114_H	1.449	1.00
131_R	165_H	1.413	1.00
166_C	173_L	1.407	1.00
134_T	174_A	1.356	1.00
116_E	128_M	1.346	1.00
165_H	174_A	1.329	1.00
75_G	94_V	1.307	1.00
81_L	175_I	1.294	1.00
18_P	42_S	1.284	1.00
145_G	148_W	1.280	1.00
140_V	147_A	1.278	1.00
139_I	143_R	1.249	1.00
72_S	79_A	1.228	1.00
50_E	62_A	1.220	0.99
40_L	80_L	1.202	0.99
16_P	19_P	1.200	0.99
37_G	78_I	1.200	0.99
95_I	130_W	1.190	0.99
16_P	20_G	1.182	0.99
58_K	70_N	1.163	0.99
14_A	18_P	1.156	0.99
140_V	153_V	1.156	0.99
117_M	120_V	1.150	0.99
138_A	176_C	1.138	0.99
28_G	32_E	1.131	0.99
26_P	30_R	1.113	0.99
21_L	53_Y	1.112	0.99
38_R	42_S	1.107	0.99
41_L	71_L	1.102	0.99
124_Q	127_E	1.099	0.99
132_I	155_S	1.080	0.99
96_R	130_W	1.078	0.99
128_M	131_R	1.068	0.99
46_S	49_P	1.065	0.99
14_A	34_W	1.063	0.99
135_R	174_A	1.056	0.99
71_L	80_L	1.055	0.99
38_R	71_L	1.046	0.98
11_T	19_P	1.036	0.98
15_A	18_P	1.035	0.98
58_K	69_F	1.034	0.98
42_S	45_L	1.021	0.98
49_P	61_F	1.020	0.98
28_G	31_R	1.013	0.98
127_E	172_S	0.996	0.98
140_V	146_S	0.992	0.98
73_H	92_I	0.991	0.98
37_G	71_L	0.987	0.98
77_D	92_I	0.982	0.98
161_L	168_L	0.975	0.98
168_L	173_L	0.961	0.97
83_S	88_V	0.955	0.97
131_R	172_S	0.949	0.97
36_A	78_I	0.943	0.97
148_W	152_S	0.937	0.97
139_I	142_Q	0.936	0.97
54_G	60_A	0.935	0.97
155_S	163_V	0.930	0.97
19_P	23_E	0.926	0.97
128_M	132_I	0.925	0.97
69_F	80_L	0.922	0.96
34_W	37_G	0.902	0.96
15_A	42_S	0.902	0.96
38_R	41_L	0.900	0.96
148_W	153_V	0.896	0.96
29_P	75_G	0.884	0.96
117_M	132_I	0.881	0.95
109_F	153_V	0.876	0.95
104_L	109_F	0.873	0.95
117_M	128_M	0.851	0.95
83_S	86_G	0.847	0.94
22_R	25_A	0.839	0.94
40_L	79_A	0.837	0.94
11_T	22_R	0.836	0.94
111_L	115_A	0.823	0.93
114_H	118_D	0.823	0.93
161_L	176_C	0.809	0.93
30_R	78_I	0.809	0.93
19_P	27_Q	0.800	0.93
91_D	137_E	0.800	0.93
13_S	43_H	0.798	0.92
74_S	134_T	0.798	0.92
48_L	51_I	0.796	0.92
102_R	125_Q	0.790	0.92
74_S	171_L	0.775	0.91
41_L	80_L	0.772	0.91
102_R	105_A	0.771	0.91
104_L	108_V	0.756	0.90
18_P	21_L	0.746	0.90
134_T	140_V	0.745	0.90
72_S	92_I	0.741	0.89
68_W	83_S	0.740	0.89
15_A	38_R	0.730	0.89
74_S	94_V	0.726	0.88
102_R	117_M	0.725	0.88
21_L	31_R	0.724	0.88
41_L	45_L	0.712	0.87
149_Q	153_V	0.709	0.87
75_G	171_L	0.707	0.87
111_L	151_V	0.696	0.86
57_G	144_G	0.693	0.86
139_I	146_S	0.693	0.86
156_T	159_S	0.691	0.86
33_R	75_G	0.691	0.86
59_P	138_A	0.690	0.86
143_R	148_W	0.690	0.86
69_F	129_F	0.686	0.85
68_W	85_E	0.677	0.85
104_L	140_V	0.665	0.84
106_N	118_D	0.662	0.83
20_G	23_E	0.661	0.83
41_L	69_F	0.659	0.83
130_W	172_S	0.654	0.83
101_W	126_L	0.653	0.82
139_I	176_C	0.652	0.82
42_S	49_P	0.652	0.82
38_R	138_A	0.650	0.82
173_L	177_T	0.646	0.82
149_Q	152_S	0.643	0.82
30_R	34_W	0.640	0.81
104_L	129_F	0.640	0.81
14_A	38_R	0.640	0.81
58_K	144_G	0.635	0.81
10_S	13_S	0.630	0.80
121_H	125_Q	0.629	0.80
106_N	159_S	0.629	0.80
142_Q	176_C	0.629	0.80
54_G	87_E	0.627	0.80
105_A	117_M	0.625	0.80
72_S	90_C	0.625	0.80
93_E	105_A	0.624	0.80
135_R	138_A	0.618	0.79
97_P	126_L	0.613	0.78
49_P	53_Y	0.613	0.78
95_I	127_E	0.611	0.78
41_L	74_S	0.610	0.78
44_T	71_L	0.604	0.77
135_R	156_T	0.604	0.77
14_A	22_R	0.603	0.77
93_E	96_R	0.602	0.77
41_L	61_F	0.600	0.77
110_S	136_K	0.597	0.77
124_Q	162_S	0.593	0.76
108_V	114_H	0.593	0.76
26_P	37_G	0.592	0.76
70_N	146_S	0.590	0.76
45_L	70_N	0.586	0.75
120_V	124_Q	0.584	0.75
103_W	107_A	0.580	0.74
30_R	98_R	0.579	0.74
29_P	32_E	0.579	0.74
76_D	171_L	0.578	0.74
33_R	37_G	0.577	0.74
23_E	31_R	0.577	0.74
121_H	124_Q	0.573	0.74
29_P	46_S	0.571	0.73
143_R	146_S	0.571	0.73
109_F	139_I	0.568	0.73
33_R	36_A	0.561	0.72
163_V	168_L	0.561	0.72
94_V	130_W	0.560	0.72
11_T	35_L	0.560	0.72
68_W	86_G	0.554	0.71
139_I	155_S	0.553	0.71
101_W	108_V	0.552	0.71
165_H	172_S	0.552	0.71
165_H	168_L	0.551	0.71
162_S	177_T	0.550	0.71
10_S	35_L	0.549	0.70
40_L	43_H	0.548	0.70
15_A	34_W	0.544	0.70
135_R	154_D	0.542	0.69
25_A	34_W	0.541	0.69
109_F	150_I	0.539	0.69
134_T	165_H	0.537	0.69
132_I	135_R	0.537	0.69
38_R	53_Y	0.536	0.69
135_R	139_I	0.536	0.69
10_S	39_A	0.534	0.68
108_V	150_I	0.532	0.68
162_S	166_C	0.529	0.68
78_I	132_I	0.529	0.68
131_R	135_R	0.528	0.67
135_R	173_L	0.528	0.67
110_S	117_M	0.523	0.67
139_I	144_G	0.523	0.67
66_P	134_T	0.522	0.67
89_G	141_K	0.520	0.66
93_E	108_V	0.519	0.66
74_S	97_P	0.514	0.65
73_H	138_A	0.511	0.65
45_L	82_L	0.510	0.65
139_I	163_V	0.510	0.65
115_A	119_A	0.509	0.65
166_C	171_L	0.509	0.65
83_S	177_T	0.508	0.65
109_F	114_H	0.507	0.64
88_V	92_I	0.507	0.64
119_A	125_Q	0.503	0.64
14_A	28_G	0.502	0.64
51_I	61_F	0.501	0.63
49_P	136_K	0.501	0.63
108_V	153_V	0.500	0.63
59_P	69_F	0.500	0.63

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1qr0A	2	0.9846	100	0.3	Contact Map
2c43A	1	0.9846	100	0.318	Contact Map
4qvhA	2	0.8821	100	0.441	Contact Map
4qjkA	1	0.8974	100	0.455	Contact Map
4jm7A	3	0.5795	99.9	0.585	Contact Map
1fthA	3	0.5026	99.6	0.686	Contact Map
3hykA	3	0.5128	99.6	0.686	Contact Map
2wasA	3	0.4769	99.5	0.693	Contact Map
1f7lA	3	0.4974	99.5	0.696	Contact Map
5cxdA	3	0.5282	99.5	0.702	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.