ARSR - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ARSR - Arsenical resistance operon repressor

UniProt:	P37309	Sequences: MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12235
Length:	117 (94)
Sequences:	2565 (1867)
Seq/√Len:	192.5

ECOLI - ARSR YGAV
BACSU - SDPR ASER ARSR CZRA YBZH
HALSA - ARSR2
SULSO - Q97VE0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_E	63_R	4.993	1.00
61_L	74_S	2.959	1.00
62_D	69_V	2.361	1.00
20_G	99_I	2.284	1.00
12_I	57_S	2.232	1.00
33_V	51_L	2.216	1.00
30_E	72_R	2.199	1.00
52_A	56_E	2.182	1.00
64_K	69_V	2.179	1.00
61_L	72_R	2.157	1.00
25_L	60_L	2.112	1.00
55_R	62_D	2.043	1.00
37_C	44_Q	2.032	1.00
42_Q	46_K	1.872	1.00
46_K	49_R	1.653	1.00
95_K	99_I	1.604	1.00
42_Q	47_I	1.553	1.00
21_I	36_L	1.512	1.00
8_Q	56_E	1.498	1.00
13_L	22_V	1.451	1.00
40_L	47_I	1.447	1.00
36_L	47_I	1.447	1.00
24_L	39_A	1.445	1.00
12_I	53_L	1.431	1.00
51_L	60_L	1.351	1.00
22_V	73_L	1.332	1.00
7_I	16_E	1.281	1.00
53_L	57_S	1.279	1.00
54_L	60_L	1.263	1.00
32_C	68_W	1.251	1.00
22_V	59_L	1.221	1.00
34_C	37_C	1.194	1.00
82_A	86_D	1.187	1.00
43_S	46_K	1.159	1.00
61_L	75_P	1.143	1.00
21_I	25_L	1.124	1.00
7_I	19_L	1.121	1.00
34_C	68_W	1.121	1.00
19_L	22_V	1.114	1.00
96_V	100_V	1.071	1.00
33_V	44_Q	1.066	1.00
11_K	64_K	1.053	1.00
25_L	31_L	1.047	1.00
10_F	81_A	1.043	1.00
31_L	35_D	1.034	1.00
77_I	80_W	1.034	1.00
27_E	100_V	0.992	0.99
94_E	98_A	0.980	0.99
93_Q	97_Q	0.976	0.99
49_R	67_K	0.973	0.99
83_K	86_D	0.906	0.99
24_L	31_L	0.898	0.99
35_D	38_T	0.895	0.99
9_L	81_A	0.887	0.99
84_I	88_A	0.887	0.99
33_V	49_R	0.886	0.99
17_T	47_I	0.874	0.99
97_Q	100_V	0.860	0.99
83_K	87_E	0.859	0.99
15_D	49_R	0.858	0.99
37_C	47_I	0.853	0.98
12_I	59_L	0.852	0.98
82_A	89_W	0.841	0.98
79_A	83_K	0.833	0.98
96_V	99_I	0.831	0.98
51_L	71_Y	0.826	0.98
76_H	79_A	0.824	0.98
34_C	64_K	0.823	0.98
86_D	89_W	0.822	0.98
33_V	39_A	0.818	0.98
30_E	65_Q	0.814	0.98
53_L	56_E	0.811	0.98
58_G	74_S	0.805	0.98
10_F	13_L	0.801	0.98
9_L	57_S	0.797	0.98
65_Q	68_W	0.796	0.98
49_R	53_L	0.787	0.97
17_T	42_Q	0.782	0.97
31_L	36_L	0.781	0.97
21_I	51_L	0.768	0.97
52_A	55_R	0.762	0.97
23_L	88_A	0.754	0.97
47_I	52_A	0.741	0.96
31_L	70_H	0.740	0.96
51_L	55_R	0.735	0.96
92_E	99_I	0.727	0.96
27_E	93_Q	0.720	0.96
87_E	91_C	0.715	0.95
67_K	73_L	0.706	0.95
8_Q	83_K	0.704	0.95
23_L	26_S	0.703	0.95
15_D	68_W	0.692	0.95
12_I	54_L	0.684	0.94
49_R	62_D	0.684	0.94
31_L	39_A	0.679	0.94
41_D	91_C	0.666	0.93
17_T	67_K	0.663	0.93
62_D	71_Y	0.663	0.93
30_E	70_H	0.658	0.93
49_R	52_A	0.655	0.93
76_H	94_E	0.645	0.92
87_E	90_R	0.644	0.92
83_K	91_C	0.642	0.92
32_C	35_D	0.638	0.92
11_K	15_D	0.637	0.92
27_E	97_Q	0.633	0.92
15_D	46_K	0.622	0.91
60_L	71_Y	0.620	0.91
65_Q	70_H	0.615	0.90
81_A	84_I	0.614	0.90
83_K	100_V	0.611	0.90
85_I	88_A	0.610	0.90
21_I	47_I	0.608	0.90
23_L	27_E	0.604	0.90
46_K	50_H	0.602	0.89
20_G	24_L	0.598	0.89
25_L	29_G	0.596	0.89
35_D	70_H	0.594	0.89
6_P	10_F	0.585	0.88
55_R	71_Y	0.575	0.87
29_G	34_C	0.575	0.87
42_Q	49_R	0.571	0.87
10_F	19_L	0.563	0.86
77_I	84_I	0.562	0.86
10_F	85_I	0.559	0.86
20_G	39_A	0.558	0.86
26_S	96_V	0.556	0.85
55_R	60_L	0.551	0.85
10_F	14_A	0.547	0.85
19_L	84_I	0.545	0.84
47_I	51_L	0.543	0.84
8_Q	57_S	0.543	0.84
42_Q	45_P	0.531	0.83
13_L	16_E	0.527	0.82
43_S	67_K	0.522	0.82
88_A	91_C	0.516	0.81
24_L	40_L	0.515	0.81
88_A	92_E	0.513	0.81
80_W	88_A	0.505	0.80
37_C	45_P	0.505	0.80
64_K	68_W	0.500	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1u2wA	2	0.7949	99.7	0.531	Contact Map
1r1tA	2	0.7778	99.6	0.537	Contact Map
3f6vA	2	0.8205	99.6	0.539	Contact Map
2kkoA	2	0.8462	99.6	0.541	Contact Map
2zkzA	2	0.7436	99.6	0.549	Contact Map
4k2eA	2	0.7692	99.6	0.552	Contact Map
2jscA	2	0.8291	99.6	0.554	Contact Map
1q1hA	1	0.6752	99.6	0.558	Contact Map
3pqkA	2	0.812	99.6	0.559	Contact Map
1r1uA	2	0.7863	99.6	0.564	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.