FXSA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FXSA - UPF0716 protein FxsA

UniProt:	P37147	Sequences: MRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQKMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLTVKLMPHLRFSRMPGGGFSAGTGGGNTFDGEYQRKDDERDRLDHKDDRQD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12382
Length:	158 (142)
Sequences:	1479 (1080)
Seq/√Len:	90.6

ECOLI - FXSA
BACSU - YTZA
HALSA - Q9HNX1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_V	33_L	4.142	1.00
23_V	90_F	3.646	1.00
15_I	91_F	3.527	1.00
81_A	99_L	3.162	1.00
101_L	104_V	3.047	1.00
19_I	91_F	2.690	1.00
61_K	66_E	2.669	1.00
38_F	42_I	2.460	1.00
18_S	29_V	2.357	1.00
74_K	109_T	2.324	1.00
59_Q	63_A	2.313	1.00
27_L	31_L	2.263	1.00
39_T	96_G	2.185	1.00
12_Y	92_T	2.105	1.00
83_L	87_L	2.067	1.00
47_V	82_G	1.980	1.00
57_L	71_E	1.898	1.00
56_V	59_Q	1.871	1.00
124_G	128_A	1.836	1.00
36_V	39_T	1.792	1.00
20_F	90_F	1.790	1.00
98_L	108_L	1.755	1.00
104_V	107_H	1.700	1.00
44_M	86_L	1.684	1.00
115_H	118_F	1.628	1.00
34_V	38_F	1.612	1.00
54_N	78_L	1.581	1.00
74_K	105_Q	1.528	1.00
10_F	13_V	1.495	1.00
60_Q	64_A	1.494	1.00
14_Y	18_S	1.470	1.00
81_A	96_G	1.440	0.99
21_I	24_A	1.422	0.99
58_M	62_M	1.394	0.99
23_V	35_L	1.380	0.99
30_L	34_V	1.365	0.99
103_P	107_H	1.337	0.99
128_A	131_G	1.293	0.99
77_S	99_L	1.284	0.99
20_F	36_V	1.280	0.99
28_G	32_T	1.242	0.98
140_Y	143_K	1.240	0.98
101_L	107_H	1.211	0.98
24_A	28_G	1.207	0.98
80_I	83_L	1.187	0.98
58_M	76_V	1.162	0.97
60_Q	63_A	1.138	0.97
51_G	75_S	1.129	0.97
39_T	92_T	1.125	0.97
45_S	49_N	1.121	0.97
20_F	32_T	1.115	0.97
12_Y	91_F	1.114	0.97
104_V	109_T	1.114	0.97
87_L	97_L	1.104	0.97
106_K	109_T	1.089	0.96
81_A	104_V	1.089	0.96
82_G	93_D	1.086	0.96
6_F	9_I	1.063	0.96
22_Q	25_H	1.051	0.95
26_V	30_L	1.043	0.95
94_F	98_L	1.028	0.95
117_R	121_M	1.023	0.95
19_I	23_V	1.011	0.94
77_S	108_L	1.011	0.94
82_G	86_L	1.009	0.94
39_T	86_L	0.999	0.94
61_K	71_E	0.999	0.94
27_L	90_F	0.985	0.94
39_T	93_D	0.984	0.94
24_A	29_V	0.976	0.93
51_G	93_D	0.975	0.93
58_M	77_S	0.970	0.93
17_I	20_F	0.965	0.93
140_Y	145_D	0.963	0.93
48_R	52_F	0.938	0.92
50_Q	53_K	0.932	0.92
11_L	14_Y	0.913	0.91
39_T	97_L	0.911	0.91
52_F	69_A	0.909	0.90
68_P	75_S	0.905	0.90
56_V	60_Q	0.905	0.90
53_K	57_L	0.903	0.90
107_H	111_K	0.903	0.90
17_I	76_V	0.899	0.90
126_F	130_T	0.894	0.90
127_S	130_T	0.893	0.90
36_V	96_G	0.890	0.90
14_Y	17_I	0.881	0.89
5_P	44_M	0.875	0.89
46_L	50_Q	0.869	0.88
142_R	145_D	0.868	0.88
72_M	79_I	0.863	0.88
127_S	132_G	0.860	0.88
78_L	105_Q	0.856	0.88
17_I	21_I	0.848	0.87
58_M	75_S	0.845	0.87
132_G	135_T	0.845	0.87
140_Y	144_D	0.837	0.86
125_G	130_T	0.836	0.86
35_L	90_F	0.836	0.86
54_N	57_L	0.836	0.86
138_G	143_K	0.828	0.86
123_G	135_T	0.819	0.85
44_M	87_L	0.818	0.85
133_G	136_F	0.815	0.85
20_F	91_F	0.803	0.84
50_Q	100_L	0.799	0.84
100_L	106_K	0.797	0.84
75_S	96_G	0.789	0.83
125_G	131_G	0.788	0.83
13_V	17_I	0.787	0.83
103_P	106_K	0.785	0.83
91_F	111_K	0.785	0.83
138_G	142_R	0.777	0.82
125_G	128_A	0.775	0.82
120_R	123_G	0.773	0.82
65_G	68_P	0.771	0.82
48_R	85_L	0.771	0.82
4_L	8_A	0.769	0.81
124_G	127_S	0.767	0.81
15_I	19_I	0.765	0.81
22_Q	26_V	0.765	0.81
10_F	40_S	0.760	0.81
70_A	113_M	0.752	0.80
92_T	96_G	0.750	0.80
138_G	145_D	0.746	0.79
27_L	35_L	0.734	0.78
46_L	57_L	0.729	0.78
4_L	103_P	0.729	0.78
129_G	132_G	0.729	0.78
26_V	33_L	0.729	0.78
9_I	32_T	0.726	0.78
13_V	44_M	0.724	0.77
50_Q	57_L	0.720	0.77
70_A	110_V	0.720	0.77
129_G	135_T	0.711	0.76
53_K	58_M	0.706	0.76
58_M	73_I	0.706	0.76
5_P	9_I	0.701	0.75
47_V	138_G	0.700	0.75
18_S	22_Q	0.698	0.75
16_E	50_Q	0.695	0.74
139_E	142_R	0.695	0.74
81_A	100_L	0.694	0.74
74_K	78_L	0.694	0.74
8_A	76_V	0.693	0.74
70_A	74_K	0.689	0.74
61_K	78_L	0.688	0.74
124_G	129_G	0.687	0.74
73_I	115_H	0.685	0.73
74_K	77_S	0.683	0.73
41_V	126_F	0.681	0.73
31_L	34_V	0.667	0.71
54_N	62_M	0.653	0.70
4_L	116_L	0.650	0.69
100_L	104_V	0.650	0.69
6_F	10_F	0.647	0.69
39_T	85_L	0.646	0.69
62_M	65_G	0.639	0.68
58_M	81_A	0.631	0.67
19_I	83_L	0.630	0.67
33_L	36_V	0.629	0.67
77_S	105_Q	0.624	0.66
12_Y	87_L	0.620	0.66
108_L	111_K	0.612	0.65
92_T	145_D	0.606	0.64
24_A	105_Q	0.604	0.64
99_L	104_V	0.599	0.63
47_V	79_I	0.597	0.63
53_K	81_A	0.594	0.63
40_S	86_L	0.591	0.62
8_A	13_V	0.590	0.62
73_I	76_V	0.588	0.62
19_I	22_Q	0.580	0.61
123_G	129_G	0.572	0.60
119_S	122_P	0.571	0.60
130_T	133_G	0.567	0.59
38_F	94_F	0.565	0.59
24_A	54_N	0.565	0.59
57_L	72_M	0.563	0.58
138_G	144_D	0.563	0.58
85_L	97_L	0.561	0.58
75_S	102_P	0.561	0.58
37_I	41_V	0.557	0.58
20_F	30_L	0.553	0.57
46_L	78_L	0.548	0.56
29_V	92_T	0.547	0.56
98_L	117_R	0.546	0.56
75_S	105_Q	0.544	0.56
70_A	109_T	0.542	0.56
23_V	77_S	0.541	0.55
99_L	142_R	0.540	0.55
13_V	24_A	0.540	0.55
87_L	93_D	0.537	0.55
62_M	67_N	0.532	0.54
81_A	118_F	0.531	0.54
131_G	137_D	0.529	0.54
11_L	44_M	0.529	0.54
46_L	100_L	0.527	0.54
78_L	96_G	0.526	0.53
91_F	94_F	0.521	0.53
37_I	84_L	0.520	0.53
131_G	135_T	0.518	0.52
95_L	130_T	0.514	0.52
13_V	92_T	0.512	0.52
46_L	72_M	0.512	0.52
61_K	64_A	0.512	0.52
114_P	117_R	0.512	0.52
48_R	51_G	0.511	0.51
83_L	97_L	0.507	0.51
72_M	101_L	0.504	0.50
20_F	96_G	0.503	0.50
44_M	78_L	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mt1A	3	0.6899	32.8	0.924	Contact Map
4ev6A	3	0.3354	31.2	0.925	Contact Map
4i0uA	4	0.3228	28.2	0.927	Contact Map
4dx5A	3	0.7468	22.2	0.93	Contact Map
3w9iA	3	0.6899	19	0.932	Contact Map
4k0jA	3	0.6582	16.3	0.935	Contact Map
4m64A	1	0.7278	12.7	0.938	Contact Map
3ne5A	3	0.6835	11.4	0.939	Contact Map
4pypA	1	0.6392	11.2	0.939	Contact Map
4mndA	2	0.6582	9.1	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.