CRCB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CRCB - Putative fluoride ion transporter CrcB

UniProt:	P37002	Sequences: MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12209
Length:	127 (117)
Sequences:	4198 (3195)
Seq/√Len:	295.4

ECOLI - CRCB
BACSU - CRCB2 CRCB1
HALSA - CRCB1 CRCB2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
44_G	78_T	4.408	1.00
43_I	77_L	4.251	1.00
48_I	70_T	3.268	1.00
12_G	16_S	3.204	1.00
9_F	13_G	3.176	1.00
42_L	113_M	2.611	1.00
102_N	106_N	2.448	1.00
11_G	68_L	2.269	1.00
13_G	76_G	2.188	1.00
50_I	121_F	2.173	1.00
18_A	73_F	2.148	1.00
42_L	109_G	2.062	1.00
87_V	102_N	1.941	1.00
22_L	40_A	1.885	1.00
46_F	120_L	1.830	1.00
87_V	103_V	1.747	1.00
45_A	110_S	1.737	1.00
14_T	68_L	1.707	1.00
87_V	99_A	1.695	1.00
51_G	69_I	1.689	1.00
14_T	73_F	1.643	1.00
53_A	118_F	1.633	1.00
40_A	77_L	1.590	1.00
95_R	98_W	1.561	1.00
39_T	43_I	1.556	1.00
48_I	114_T	1.547	1.00
46_F	117_A	1.527	1.00
53_A	121_F	1.437	1.00
13_G	17_V	1.435	1.00
38_L	105_V	1.434	1.00
47_I	74_C	1.433	1.00
26_F	36_G	1.406	1.00
17_V	21_L	1.389	1.00
48_I	74_C	1.377	1.00
20_W	24_M	1.344	1.00
21_L	25_R	1.344	1.00
51_G	70_T	1.290	1.00
18_A	77_L	1.259	1.00
16_S	76_G	1.244	1.00
9_F	17_V	1.229	1.00
53_A	57_R	1.229	1.00
5_L	17_V	1.225	1.00
115_A	119_W	1.224	1.00
23_S	40_A	1.216	1.00
52_F	85_A	1.214	1.00
89_F	92_Q	1.202	1.00
48_I	76_G	1.143	1.00
68_L	73_F	1.117	1.00
37_T	86_E	1.115	1.00
100_L	104_F	1.084	1.00
82_T	86_E	1.069	1.00
117_A	121_F	1.058	1.00
67_V	71_T	1.046	1.00
38_L	42_L	1.033	1.00
91_L	99_A	1.027	1.00
88_V	114_T	1.000	1.00
116_L	119_W	0.984	1.00
46_F	113_M	0.981	1.00
105_V	109_G	0.971	1.00
88_V	118_F	0.964	1.00
91_L	96_F	0.950	1.00
50_I	54_W	0.940	1.00
38_L	109_G	0.938	1.00
96_F	100_L	0.921	1.00
97_G	100_L	0.908	1.00
52_F	70_T	0.904	1.00
33_I	38_L	0.898	1.00
10_I	13_G	0.889	1.00
26_F	30_H	0.875	1.00
21_L	24_M	0.865	1.00
26_F	29_L	0.860	1.00
97_G	101_L	0.853	1.00
8_V	67_V	0.851	1.00
88_V	115_A	0.842	1.00
63_P	67_V	0.842	1.00
105_V	108_L	0.833	1.00
23_S	27_N	0.821	1.00
7_A	64_V	0.817	1.00
36_G	40_A	0.815	1.00
25_R	29_L	0.810	1.00
106_N	110_S	0.810	1.00
86_E	89_F	0.802	1.00
119_W	122_S	0.786	0.99
104_F	108_L	0.785	0.99
34_P	90_L	0.785	0.99
109_G	113_M	0.769	0.99
64_V	67_V	0.741	0.99
84_S	114_T	0.738	0.99
50_I	53_A	0.730	0.99
23_S	37_T	0.730	0.99
24_M	28_P	0.722	0.99
26_F	39_T	0.722	0.99
84_S	88_V	0.720	0.99
23_S	86_E	0.710	0.99
66_K	70_T	0.709	0.99
18_A	22_L	0.704	0.99
8_V	11_G	0.698	0.99
62_D	65_W	0.697	0.99
83_F	110_S	0.693	0.99
40_A	43_I	0.689	0.99
84_S	107_L	0.686	0.98
50_I	120_L	0.686	0.98
35_L	39_T	0.686	0.98
83_F	103_V	0.685	0.98
101_L	105_V	0.685	0.98
118_F	122_S	0.673	0.98
54_W	121_F	0.671	0.98
89_F	93_E	0.664	0.98
49_G	114_T	0.661	0.98
61_I	65_W	0.659	0.98
57_R	122_S	0.658	0.98
38_L	106_N	0.655	0.98
55_F	61_I	0.650	0.98
22_L	26_F	0.648	0.98
18_A	21_L	0.647	0.98
51_G	55_F	0.647	0.98
114_T	117_A	0.645	0.98
113_M	116_L	0.643	0.98
90_L	102_N	0.643	0.98
45_A	84_S	0.641	0.98
16_S	74_C	0.640	0.98
73_F	76_G	0.634	0.97
67_V	70_T	0.632	0.97
80_F	84_S	0.630	0.97
46_F	53_A	0.628	0.97
85_A	89_F	0.625	0.97
73_F	77_L	0.625	0.97
22_L	43_I	0.621	0.97
31_Q	98_W	0.619	0.97
65_W	68_L	0.617	0.97
52_F	56_S	0.615	0.97
49_G	53_A	0.614	0.97
11_G	83_F	0.611	0.97
45_A	114_T	0.593	0.96
33_I	90_L	0.592	0.96
5_L	67_V	0.591	0.96
6_L	10_I	0.590	0.96
76_G	83_F	0.588	0.96
22_L	77_L	0.587	0.96
115_A	118_F	0.585	0.96
112_A	115_A	0.577	0.96
5_L	21_L	0.572	0.95
32_A	98_W	0.571	0.95
103_V	107_L	0.571	0.95
118_F	121_F	0.569	0.95
14_T	17_V	0.562	0.95
19_R	72_G	0.561	0.95
85_A	114_T	0.560	0.95
112_A	116_L	0.554	0.95
22_L	36_G	0.554	0.95
30_H	35_L	0.553	0.94
111_F	114_T	0.548	0.94
7_A	68_L	0.548	0.94
28_P	31_Q	0.547	0.94
76_G	80_F	0.546	0.94
57_R	60_N	0.541	0.94
60_N	64_V	0.541	0.94
10_I	68_L	0.541	0.94
47_I	69_I	0.540	0.94
20_W	23_S	0.537	0.94
63_P	66_K	0.536	0.94
14_T	18_A	0.531	0.93
22_L	39_T	0.525	0.93
49_G	117_A	0.521	0.93
32_A	101_L	0.520	0.93
45_A	74_C	0.520	0.93
108_L	112_A	0.519	0.92
55_F	70_T	0.517	0.92
37_T	79_T	0.516	0.92
57_R	121_F	0.513	0.92
24_M	40_A	0.508	0.92
61_I	64_V	0.508	0.92
116_L	120_L	0.506	0.91
8_V	94_G	0.503	0.91
99_A	107_L	0.502	0.91
31_Q	35_L	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gfpA	2	0.9291	2.9	0.938	Contact Map
1u7gA	3	0.811	2.7	0.939	Contact Map
4hzuS	1	0.9213	2.5	0.941	Contact Map
3rlbA	1	0.9764	2.4	0.941	Contact Map
3j1zP	8	0.937	2.4	0.941	Contact Map
4dveA	3	0.9921	2.4	0.941	Contact Map
4xnjA	1	0.9528	2.3	0.941	Contact Map
4tkrA	2	0.9764	2.3	0.942	Contact Map
3h90A	3	0.937	2.1	0.943	Contact Map
2j5dA	2	0.3386	2.1	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.