CHPB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CHPB - mRNA interferase ChpB

UniProt:	P33647	Sequences: MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLVNQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12096
Length:	116 (102)
Sequences:	1550 (1030)
Seq/√Len:	102.0

ECOLI - CHPB MAZF
BACSU - ENDOA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_L	107_A	3.293	1.00
64_S	81_N	3.198	1.00
100_A	103_V	2.946	1.00
17_F	32_A	2.921	1.00
49_A	78_V	2.575	1.00
74_V	97_G	2.461	1.00
11_D	98_L	2.429	1.00
49_A	80_V	2.424	1.00
14_L	96_I	2.193	1.00
53_Q	75_H	2.149	1.00
78_V	107_A	2.108	1.00
20_A	26_Q	2.107	1.00
9_R	108_L	2.054	1.00
10_G	104_V	1.897	1.00
103_V	106_E	1.698	1.00
35_L	49_A	1.692	1.00
15_V	32_A	1.669	1.00
33_L	99_A	1.584	1.00
48_V	86_M	1.579	1.00
106_E	110_R	1.574	1.00
25_Q	79_L	1.550	1.00
8_E	38_Q	1.544	1.00
21_S	90_A	1.473	1.00
18_D	26_Q	1.410	1.00
15_V	86_M	1.368	0.99
95_R	98_L	1.349	0.99
25_Q	30_R	1.330	0.99
87_D	90_A	1.302	0.99
20_A	84_R	1.274	0.99
16_G	28_A	1.217	0.99
73_D	97_G	1.204	0.99
14_L	94_K	1.203	0.99
45_M	85_M	1.189	0.99
13_V	92_L	1.189	0.99
24_E	91_R	1.186	0.99
36_S	40_F	1.185	0.99
58_A	77_V	1.184	0.98
17_F	84_R	1.184	0.98
99_A	104_V	1.176	0.98
61_A	64_S	1.152	0.98
11_D	95_R	1.141	0.98
65_V	103_V	1.131	0.98
78_V	103_V	1.125	0.98
28_A	94_K	1.120	0.98
40_F	45_M	1.080	0.97
14_L	31_P	1.015	0.96
14_L	28_A	1.009	0.96
101_D	106_E	1.005	0.96
59_R	66_P	0.999	0.96
12_I	72_G	0.992	0.95
101_D	105_E	0.990	0.95
54_G	59_R	0.984	0.95
32_A	86_M	0.964	0.95
60_Y	64_S	0.962	0.95
17_F	20_A	0.959	0.95
17_F	48_V	0.955	0.94
40_F	43_L	0.955	0.94
68_H	72_G	0.952	0.94
68_H	100_A	0.951	0.94
64_S	77_V	0.943	0.94
38_Q	41_N	0.942	0.94
23_H	44_G	0.939	0.94
18_D	28_A	0.921	0.93
18_D	27_G	0.912	0.93
53_Q	74_V	0.908	0.93
16_G	92_L	0.908	0.93
34_V	48_V	0.907	0.93
47_L	85_M	0.900	0.93
35_L	111_L	0.896	0.92
105_E	109_L	0.879	0.92
14_L	93_A	0.876	0.91
51_I	67_L	0.873	0.91
13_V	93_A	0.866	0.91
37_V	64_S	0.866	0.91
13_V	34_V	0.852	0.90
61_A	81_N	0.821	0.89
32_A	48_V	0.817	0.88
19_P	91_R	0.815	0.88
25_Q	64_S	0.813	0.88
63_F	81_N	0.795	0.87
50_P	53_Q	0.789	0.87
12_I	51_I	0.787	0.86
36_S	46_T	0.771	0.85
40_F	81_N	0.768	0.85
64_S	79_L	0.763	0.85
104_V	107_A	0.761	0.85
37_V	81_N	0.750	0.84
59_R	62_G	0.748	0.84
12_I	74_V	0.736	0.83
67_L	72_G	0.733	0.82
36_S	77_V	0.730	0.82
105_E	112_Q	0.723	0.81
66_P	77_V	0.711	0.80
98_L	101_D	0.703	0.80
99_A	103_V	0.699	0.79
19_P	24_E	0.694	0.79
83_V	111_L	0.688	0.78
18_D	94_K	0.688	0.78
34_V	68_H	0.686	0.78
72_G	97_G	0.678	0.77
54_G	79_L	0.671	0.76
15_V	92_L	0.670	0.76
45_M	80_V	0.665	0.76
47_L	79_L	0.655	0.75
66_P	70_E	0.645	0.74
10_G	63_F	0.644	0.73
52_T	82_Q	0.636	0.72
13_V	46_T	0.632	0.72
51_I	76_G	0.623	0.71
73_D	100_A	0.622	0.71
35_L	65_V	0.622	0.71
63_F	80_V	0.621	0.71
40_F	63_F	0.616	0.70
94_K	109_L	0.615	0.70
33_L	50_P	0.615	0.70
108_L	112_Q	0.614	0.70
49_A	83_V	0.613	0.70
47_L	83_V	0.612	0.70
38_Q	42_Q	0.611	0.69
23_H	86_M	0.602	0.68
48_V	97_G	0.600	0.68
41_N	111_L	0.598	0.68
10_G	108_L	0.588	0.67
16_G	93_A	0.577	0.65
12_I	97_G	0.576	0.65
20_A	49_A	0.576	0.65
49_A	107_A	0.576	0.65
40_F	47_L	0.571	0.64
37_V	40_F	0.564	0.63
21_S	38_Q	0.561	0.63
12_I	99_A	0.559	0.63
11_D	89_H	0.551	0.62
7_F	95_R	0.549	0.61
25_Q	81_N	0.542	0.60
27_G	64_S	0.542	0.60
39_A	109_L	0.542	0.60
108_L	111_L	0.540	0.60
16_G	21_S	0.534	0.59
63_F	79_L	0.530	0.59
54_G	64_S	0.527	0.58
54_G	77_V	0.525	0.58
21_S	42_Q	0.517	0.57
44_G	90_A	0.515	0.56
50_P	59_R	0.515	0.56
27_G	79_L	0.514	0.56
23_H	45_M	0.510	0.56
22_G	90_A	0.508	0.55
80_V	107_A	0.508	0.55
21_S	102_E	0.505	0.55
41_N	84_R	0.505	0.55
43_L	47_L	0.501	0.54
39_A	94_K	0.501	0.54
10_G	79_L	0.500	0.54

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ub4A	2	0.8793	100	0.275	Contact Map
4mzmA	2	0.9397	100	0.282	Contact Map
1m1fA	2	0.9138	100	0.29	Contact Map
4mdxA	2	0.9483	100	0.319	Contact Map
2kmtA	2	0.8621	99.1	0.679	Contact Map
3vubA	2	0.8362	98.9	0.704	Contact Map
4eyzA	1	0.5862	25.3	0.922	Contact Map
3pmiA	4	0.6638	19.8	0.926	Contact Map
3nr7A	2	0.319	16.2	0.928	Contact Map
2l89A	1	0.8103	15	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.