SFGH2 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SFGH2 - S-formylglutathione hydrolase YeiG

UniProt:	P33018	Sequences: MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLSGLTCNDENFTTKAGAQRVAAELGIVLVMPDTSPRGEKVANDDGYDLGQGAGFYLNATQPPWATHYRMYDYLRDELPALVQSQFNVSDRCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSVPWGIKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAEAARQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQYLLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12026
Length:	278 (227)
Sequences:	8474 (6184)
Seq/√Len:	410.5

ECOLI - SFGH2 SFGH1 FES YIEL
BACSU - BESA YJCH YBBA
SULSO - Q97UM5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
155_A	165_V	3.989	1.00
130_Q	139_C	3.393	1.00
20_D	27_P	3.272	1.00
236_A	240_R	2.863	1.00
167_A	170_P	2.727	1.00
128_L	132_Q	2.669	1.00
130_Q	135_V	2.503	1.00
119_D	123_D	2.442	1.00
221_D	252_P	2.442	1.00
168_F	268_H	2.316	1.00
105_N	119_D	2.296	1.00
118_Y	158_N	2.274	1.00
249_R	267_D	2.248	1.00
75_V	135_V	2.227	1.00
238_A	242_K	2.224	1.00
37_P	73_G	2.195	1.00
18_R	27_P	2.185	1.00
233_A	250_I	2.142	1.00
236_A	246_M	2.134	1.00
46_L	74_I	2.073	1.00
43_P	75_V	2.026	1.00
46_L	142_S	2.018	1.00
45_V	77_V	2.009	1.00
118_Y	154_M	1.996	1.00
47_Y	139_C	1.996	1.00
20_D	25_N	1.949	1.00
38_R	134_N	1.924	1.00
218_D	264_F	1.907	1.00
77_V	129_V	1.812	1.00
166_S	268_H	1.801	1.00
38_R	43_P	1.788	1.00
140_A	164_S	1.754	1.00
48_W	142_S	1.741	1.00
32_I	77_V	1.705	1.00
126_P	139_C	1.691	1.00
16_R	29_T	1.659	1.00
19_H	120_Y	1.645	1.00
18_R	29_T	1.607	1.00
67_R	71_E	1.589	1.00
122_R	158_N	1.557	1.00
266_E	270_R	1.535	1.00
47_Y	130_Q	1.533	1.00
66_Q	70_A	1.529	1.00
17_W	30_F	1.528	1.00
120_Y	125_L	1.522	1.00
118_Y	157_K	1.515	1.00
34_L	75_V	1.513	1.00
237_E	241_Q	1.497	1.00
165_V	215_T	1.488	1.00
41_T	73_G	1.477	1.00
47_Y	126_P	1.471	1.00
170_P	232_P	1.468	1.00
234_V	237_E	1.450	1.00
196_L	202_A	1.401	1.00
99_G	102_F	1.391	1.00
233_A	237_E	1.388	1.00
193_N	196_L	1.384	1.00
164_S	214_P	1.382	1.00
237_E	240_R	1.379	1.00
30_F	125_L	1.365	1.00
129_V	135_V	1.335	1.00
21_S	124_E	1.324	1.00
153_I	198_W	1.304	1.00
153_I	157_K	1.296	1.00
152_L	172_V	1.284	1.00
144_H	261_I	1.283	1.00
99_G	103_Y	1.274	1.00
221_D	250_I	1.274	1.00
64_G	67_R	1.263	1.00
123_D	127_A	1.262	1.00
173_N	234_V	1.260	1.00
216_L	249_R	1.256	1.00
141_I	151_A	1.249	1.00
126_P	161_K	1.247	1.00
236_A	250_I	1.244	1.00
151_A	165_V	1.244	1.00
126_P	130_Q	1.241	1.00
15_Q	133_F	1.234	1.00
123_D	158_N	1.209	1.00
236_A	248_L	1.206	1.00
72_L	269_L	1.204	1.00
23_T	123_D	1.194	1.00
23_T	124_E	1.193	1.00
238_A	241_Q	1.188	1.00
48_W	59_F	1.181	1.00
60_T	78_M	1.180	1.00
16_R	31_S	1.177	1.00
49_L	150_G	1.163	1.00
49_L	117_M	1.161	1.00
169_A	261_I	1.152	1.00
199_D	202_A	1.145	1.00
99_G	105_N	1.141	1.00
23_T	119_D	1.136	1.00
55_N	58_N	1.128	1.00
122_R	161_K	1.125	1.00
68_V	266_E	1.120	1.00
232_P	248_L	1.118	1.00
122_R	154_M	1.118	1.00
45_V	135_V	1.117	1.00
72_L	270_R	1.106	1.00
46_L	76_L	1.101	1.00
15_Q	34_L	1.100	1.00
142_S	166_S	1.084	1.00
100_A	103_Y	1.073	1.00
203_L	206_A	1.064	1.00
152_L	167_A	1.058	1.00
139_C	161_K	1.056	1.00
42_P	134_N	1.053	1.00
202_A	205_Y	1.052	1.00
30_F	120_Y	1.052	1.00
68_V	71_E	1.050	1.00
30_F	128_L	1.049	1.00
168_F	261_I	1.044	1.00
158_N	161_K	1.039	1.00
148_G	167_A	1.038	1.00
28_M	120_Y	1.030	1.00
17_W	132_Q	1.015	1.00
21_S	24_L	1.004	1.00
214_P	271_F	1.000	1.00
239_A	246_M	0.999	1.00
57_E	61_T	0.996	1.00
22_S	124_E	0.995	1.00
59_F	63_A	0.991	1.00
43_P	134_N	0.988	1.00
207_S	211_D	0.988	1.00
240_R	246_M	0.984	1.00
48_W	78_M	0.983	1.00
118_Y	122_R	0.982	1.00
226_L	233_A	0.976	1.00
17_W	128_L	0.974	1.00
128_L	131_S	0.965	1.00
120_Y	124_E	0.960	1.00
126_P	162_Y	0.956	1.00
217_I	236_A	0.951	1.00
47_Y	77_V	0.951	1.00
173_N	176_S	0.944	1.00
75_V	133_F	0.940	1.00
69_A	76_L	0.938	1.00
153_I	200_S	0.935	1.00
37_P	43_P	0.930	1.00
122_R	162_Y	0.927	1.00
251_Q	264_F	0.918	1.00
202_A	206_A	0.909	1.00
221_D	251_Q	0.906	1.00
141_I	154_M	0.903	1.00
63_A	258_Y	0.898	1.00
16_R	56_D	0.895	1.00
217_I	232_P	0.894	1.00
29_T	80_D	0.885	1.00
47_Y	129_V	0.882	1.00
45_V	139_C	0.882	1.00
29_T	56_D	0.882	1.00
194_A	197_E	0.880	1.00
149_H	153_I	0.880	1.00
214_P	245_P	0.880	1.00
138_R	163_T	0.877	1.00
151_A	167_A	0.875	1.00
64_G	68_V	0.873	1.00
44_P	74_I	0.870	1.00
42_P	136_S	0.868	1.00
45_V	75_V	0.860	1.00
239_A	244_W	0.856	1.00
47_Y	162_Y	0.854	1.00
31_S	56_D	0.852	1.00
264_F	267_D	0.852	1.00
121_L	154_M	0.847	1.00
65_A	76_L	0.844	1.00
116_R	119_D	0.841	1.00
172_V	235_L	0.839	1.00
126_P	129_V	0.839	1.00
16_R	57_E	0.839	1.00
217_I	235_L	0.832	1.00
102_F	105_N	0.823	1.00
49_L	79_P	0.822	1.00
166_S	272_H	0.820	1.00
267_D	270_R	0.813	1.00
39_D	42_P	0.812	1.00
205_Y	241_Q	0.812	1.00
77_V	125_L	0.809	1.00
247_T	271_F	0.808	1.00
235_L	239_A	0.808	1.00
49_L	141_I	0.807	1.00
145_S	256_H	0.801	1.00
251_Q	260_F	0.795	1.00
60_T	63_A	0.794	1.00
66_Q	69_A	0.793	1.00
155_A	213_I	0.790	1.00
43_P	73_G	0.786	1.00
102_F	106_A	0.781	1.00
122_R	127_A	0.781	1.00
97_G	101_G	0.780	1.00
222_N	253_G	0.779	1.00
205_Y	208_N	0.778	1.00
195_W	199_D	0.776	1.00
204_M	207_S	0.768	1.00
217_I	246_M	0.767	1.00
193_N	197_E	0.754	1.00
98_Q	102_F	0.751	1.00
31_S	80_D	0.748	1.00
34_L	43_P	0.745	1.00
22_S	25_N	0.744	1.00
201_C	205_Y	0.744	1.00
24_L	28_M	0.743	1.00
105_N	116_R	0.739	1.00
17_W	133_F	0.735	1.00
204_M	242_K	0.731	1.00
218_D	251_Q	0.729	1.00
34_L	38_R	0.728	1.00
260_F	264_F	0.726	1.00
104_L	153_I	0.725	1.00
127_A	162_Y	0.723	1.00
221_D	253_G	0.720	1.00
142_S	168_F	0.718	1.00
167_A	217_I	0.715	1.00
65_A	69_A	0.715	1.00
54_C	58_N	0.715	1.00
157_K	197_E	0.711	1.00
52_L	100_A	0.704	1.00
144_H	258_Y	0.703	1.00
127_A	161_K	0.703	1.00
50_S	58_N	0.700	1.00
212_A	244_W	0.699	1.00
139_C	163_T	0.698	1.00
49_L	151_A	0.692	1.00
50_S	54_C	0.691	1.00
142_S	265_I	0.690	1.00
44_P	138_R	0.685	1.00
141_I	165_V	0.684	1.00
149_H	200_S	0.684	1.00
130_Q	161_K	0.683	1.00
79_P	121_L	0.676	1.00
38_R	42_P	0.675	0.99
45_V	130_Q	0.675	0.99
196_L	206_A	0.674	0.99
14_Q	60_T	0.673	0.99
231_Q	234_V	0.671	0.99
122_R	126_P	0.670	0.99
67_R	70_A	0.667	0.99
33_F	70_A	0.663	0.99
152_L	170_P	0.661	0.99
123_D	161_K	0.655	0.99
103_Y	106_A	0.654	0.99
147_G	150_G	0.644	0.99
205_Y	238_A	0.642	0.99
23_T	116_R	0.642	0.99
32_I	133_F	0.642	0.99
58_N	258_Y	0.641	0.99
48_W	265_I	0.641	0.99
33_F	36_P	0.640	0.99
31_S	57_E	0.635	0.99
65_A	68_V	0.634	0.99
68_V	72_L	0.634	0.99
130_Q	136_S	0.634	0.99
97_G	100_A	0.633	0.99
68_V	270_R	0.627	0.99
39_D	134_N	0.626	0.99
152_L	215_T	0.625	0.99
129_V	133_F	0.621	0.99
164_S	272_H	0.619	0.99
164_S	271_F	0.618	0.99
148_G	170_P	0.618	0.99
227_A	231_Q	0.615	0.99
219_Q	232_P	0.614	0.99
215_T	239_A	0.611	0.99
168_F	218_D	0.611	0.99
98_Q	186_S	0.610	0.99
72_L	273_A	0.608	0.99
33_F	76_L	0.608	0.99
144_H	170_P	0.606	0.99
63_A	262_A	0.604	0.99
201_C	238_A	0.602	0.99
265_I	269_L	0.599	0.99
251_Q	267_D	0.599	0.99
208_N	211_D	0.597	0.99
64_G	262_A	0.595	0.99
44_P	136_S	0.595	0.99
220_G	253_G	0.594	0.99
34_L	133_F	0.593	0.99
127_A	131_S	0.593	0.99
251_Q	263_S	0.593	0.99
98_Q	103_Y	0.590	0.99
68_V	269_L	0.589	0.99
64_G	69_A	0.589	0.99
97_G	102_F	0.588	0.99
59_F	65_A	0.586	0.99
100_A	105_N	0.582	0.99
19_H	30_F	0.578	0.98
117_M	150_G	0.577	0.98
218_D	260_F	0.576	0.98
61_T	66_Q	0.575	0.98
102_F	146_M	0.574	0.98
118_Y	153_I	0.572	0.98
57_E	60_T	0.569	0.98
255_D	260_F	0.564	0.98
114_H	150_G	0.561	0.98
38_R	75_V	0.561	0.98
213_I	244_W	0.559	0.98
63_A	66_Q	0.558	0.98
63_A	68_V	0.558	0.98
232_P	246_M	0.556	0.98
247_T	267_D	0.555	0.98
142_S	268_H	0.552	0.98
51_G	145_S	0.548	0.98
204_M	239_A	0.546	0.98
218_D	249_R	0.545	0.98
59_F	78_M	0.540	0.98
45_V	76_L	0.537	0.98
45_V	129_V	0.536	0.97
223_D	226_L	0.536	0.97
118_Y	198_W	0.536	0.97
44_P	73_G	0.536	0.97
58_N	61_T	0.535	0.97
50_S	55_N	0.534	0.97
186_S	189_G	0.534	0.97
101_G	104_L	0.532	0.97
230_L	234_V	0.532	0.97
103_Y	150_G	0.530	0.97
59_F	144_H	0.529	0.97
46_L	140_A	0.524	0.97
58_N	144_H	0.524	0.97
201_C	204_M	0.524	0.97
155_A	159_P	0.523	0.97
168_F	264_F	0.523	0.97
40_H	134_N	0.522	0.97
28_M	125_L	0.522	0.97
24_L	124_E	0.520	0.97
59_F	261_I	0.518	0.97
60_T	66_Q	0.517	0.97
55_N	59_F	0.515	0.97
41_T	134_N	0.514	0.97
68_V	265_I	0.514	0.97
32_I	75_V	0.512	0.97
127_A	130_Q	0.512	0.97
227_A	233_A	0.512	0.97
217_I	239_A	0.509	0.97
100_A	106_A	0.507	0.96
171_I	174_P	0.506	0.96
263_S	267_D	0.502	0.96
14_Q	66_Q	0.501	0.96
233_A	236_A	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ls2A	2	0.9964	100	0.348	Contact Map
3i6yA	1	0.9928	100	0.383	Contact Map
3e4dA	3	0.9892	100	0.394	Contact Map
4folA	2	0.9784	100	0.4	Contact Map
3fcxA	2	0.9964	100	0.42	Contact Map
4b6gA	1	0.9892	100	0.432	Contact Map
4rotA	4	0.8741	100	0.452	Contact Map
4w9rA	2	0.8094	100	0.46	Contact Map
2uz0A	4	0.8489	100	0.461	Contact Map
3gffA	2	0.8633	100	0.476	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0091 seconds.