FSAB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FSAB - Fructose-6-phosphate aldolase 2

UniProt:	P32669	Sequences: MELYLDTANVAEVERLARIFPIAGVTTNPSIIAASKESIWEVLPRLQKAIGDEGILFAQTMSRDAQGMVEEAKRLRDAIPGIVVKIPVTSEGLAAIKILKKEGITTLGTAVYSAAQGLLAALAGAKYVAPYVNRVDAQGGDGIRTVQELQTLLEMHAPESMVLAASFKTPRQALDCLLAGCESITLPLDVAQQMLNTPAVESAIEKFEHDWNAAFGTTHL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11905
Length:	220 (208)
Sequences:	3868 (2069)
Seq/√Len:	143.5

ECOLI - FSAB FSAA TALB TALA
BACSU - TAL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
73_K	102_E	5.904	1.00
64_D	67_G	4.890	1.00
44_P	48_K	2.936	1.00
205_E	209_H	2.660	1.00
9_N	35_S	2.554	1.00
96_I	108_G	2.521	1.00
69_V	98_I	2.519	1.00
15_R	192_Q	2.446	1.00
150_Q	162_V	2.424	1.00
150_Q	154_E	2.422	1.00
30_S	210_D	2.399	1.00
117_G	149_L	2.280	1.00
88_V	111_V	2.257	1.00
23_A	122_L	2.218	1.00
97_K	101_K	2.215	1.00
202_S	206_K	2.139	1.00
98_I	102_E	2.131	1.00
189_D	193_Q	2.034	1.00
94_A	97_K	2.014	1.00
209_H	213_A	1.962	1.00
65_A	94_A	1.929	1.00
45_R	48_K	1.868	1.00
70_E	74_R	1.787	1.00
97_K	126_K	1.717	1.00
128_V	153_L	1.715	1.00
72_A	76_R	1.687	1.00
11_A	14_E	1.675	1.00
86_I	99_L	1.666	1.00
114_A	152_L	1.652	1.00
126_K	161_M	1.643	1.00
66_Q	70_E	1.631	1.00
14_E	18_R	1.592	1.00
86_I	96_I	1.544	1.00
69_V	95_A	1.540	1.00
72_A	99_L	1.532	1.00
148_E	178_L	1.530	1.00
62_S	67_G	1.528	1.00
32_I	39_I	1.512	1.00
63_R	91_E	1.497	1.00
209_H	212_N	1.470	1.00
100_K	126_K	1.456	1.00
73_K	98_I	1.443	1.00
121_A	156_H	1.441	1.00
63_R	204_I	1.434	1.00
65_A	98_I	1.424	1.00
58_A	75_L	1.415	1.00
57_F	107_L	1.414	1.00
116_Q	200_V	1.413	1.00
135_V	140_G	1.405	1.00
65_A	91_E	1.400	1.00
75_L	78_A	1.399	1.00
141_D	144_R	1.389	1.00
40_W	74_R	1.369	1.00
206_K	209_H	1.358	1.00
63_R	208_E	1.355	1.00
173_A	190_V	1.351	1.00
12_E	188_L	1.346	1.00
202_S	205_E	1.341	1.00
201_E	205_E	1.340	1.00
9_N	12_E	1.335	1.00
105_T	126_K	1.313	1.00
144_R	148_E	1.313	1.00
147_Q	151_T	1.307	1.00
15_R	19_I	1.305	1.00
37_E	42_V	1.289	1.00
164_A	167_F	1.281	1.00
114_A	148_E	1.279	1.00
106_T	126_K	1.264	1.00
161_M	183_S	1.258	1.00
74_R	77_D	1.257	1.00
107_L	129_A	1.247	1.00
73_K	104_I	1.238	1.00
14_E	45_R	1.233	1.00
59_Q	131_Y	1.220	1.00
100_K	124_G	1.211	1.00
16_L	188_L	1.210	1.00
60_T	68_M	1.208	1.00
93_L	119_L	1.200	1.00
65_A	69_V	1.188	1.00
118_L	152_L	1.185	1.00
197_T	201_E	1.168	1.00
61_M	208_E	1.162	1.00
72_A	86_I	1.140	0.99
46_L	50_I	1.138	0.99
56_L	79_I	1.137	0.99
88_V	108_G	1.133	0.99
186_L	191_A	1.133	0.99
18_R	94_A	1.133	0.99
38_S	41_E	1.108	0.99
68_M	86_I	1.103	0.99
91_E	94_A	1.074	0.99
90_S	195_L	1.070	0.99
121_A	153_L	1.069	0.99
73_K	77_D	1.064	0.99
10_V	42_V	1.062	0.99
39_I	211_W	1.057	0.99
68_M	72_A	1.053	0.99
152_L	156_H	1.044	0.99
199_A	203_A	1.034	0.99
163_L	183_S	1.030	0.99
43_L	82_I	1.030	0.99
151_T	155_M	1.022	0.99
5_L	191_A	1.020	0.99
43_L	58_A	1.013	0.99
66_Q	98_I	1.013	0.99
110_A	203_A	1.009	0.99
76_R	104_I	1.005	0.99
72_A	84_V	0.996	0.99
22_I	191_A	0.994	0.98
121_A	152_L	0.990	0.98
70_E	73_K	0.989	0.98
69_V	99_L	0.985	0.98
33_A	213_A	0.976	0.98
199_A	202_S	0.975	0.98
74_R	78_A	0.973	0.98
122_L	158_P	0.971	0.98
65_A	95_A	0.967	0.98
193_Q	196_N	0.964	0.98
34_A	189_D	0.956	0.98
42_V	45_R	0.955	0.98
164_A	176_C	0.952	0.98
173_A	186_L	0.945	0.98
170_P	193_Q	0.943	0.98
83_V	127_Y	0.937	0.98
110_A	131_Y	0.936	0.98
143_I	176_C	0.936	0.98
147_Q	179_A	0.935	0.98
96_I	106_T	0.935	0.98
58_A	82_I	0.933	0.98
67_G	70_E	0.924	0.98
37_E	45_R	0.922	0.98
133_N	168_K	0.921	0.98
69_V	73_K	0.920	0.97
69_V	72_A	0.917	0.97
40_W	44_P	0.911	0.97
114_A	118_L	0.908	0.97
16_L	192_Q	0.906	0.97
76_R	105_T	0.897	0.97
36_K	42_V	0.892	0.97
205_E	208_E	0.891	0.97
203_A	207_F	0.887	0.97
107_L	110_A	0.882	0.97
88_V	96_I	0.881	0.97
144_R	147_Q	0.875	0.97
107_L	131_Y	0.869	0.96
198_P	202_S	0.869	0.96
64_D	72_A	0.868	0.96
111_V	153_L	0.865	0.96
5_L	16_L	0.865	0.96
188_L	192_Q	0.865	0.96
192_Q	196_N	0.864	0.96
32_I	42_V	0.864	0.96
206_K	210_D	0.863	0.96
41_E	79_I	0.855	0.96
98_I	101_K	0.851	0.96
12_E	192_Q	0.844	0.96
39_I	43_L	0.839	0.96
72_A	78_A	0.837	0.96
208_E	212_N	0.837	0.96
72_A	77_D	0.837	0.96
47_Q	56_L	0.833	0.96
90_S	192_Q	0.832	0.95
14_E	49_A	0.827	0.95
11_A	15_R	0.827	0.95
149_L	153_L	0.825	0.95
68_M	95_A	0.821	0.95
59_Q	129_A	0.819	0.95
164_A	179_A	0.817	0.95
17_A	43_L	0.815	0.95
57_F	129_A	0.813	0.95
130_P	149_L	0.798	0.94
108_G	125_A	0.788	0.94
134_R	166_S	0.787	0.94
136_D	142_G	0.784	0.94
76_R	82_I	0.781	0.94
12_E	15_R	0.777	0.94
170_P	190_V	0.775	0.93
166_S	185_T	0.775	0.93
63_R	72_A	0.771	0.93
132_V	142_G	0.771	0.93
10_V	45_R	0.770	0.93
135_V	145_T	0.770	0.93
71_E	78_A	0.761	0.93
85_K	185_T	0.756	0.93
34_A	206_K	0.747	0.92
150_Q	182_E	0.745	0.92
71_E	75_L	0.743	0.92
122_L	156_H	0.742	0.92
59_Q	107_L	0.738	0.92
100_K	105_T	0.735	0.92
67_G	71_E	0.735	0.92
111_V	128_V	0.723	0.91
89_T	204_I	0.723	0.91
64_D	68_M	0.716	0.90
13_V	46_L	0.711	0.90
8_A	27_T	0.709	0.90
140_G	171_R	0.708	0.90
88_V	93_L	0.707	0.90
129_A	203_A	0.705	0.90
148_E	151_T	0.702	0.90
20_F	192_Q	0.695	0.89
28_N	109_T	0.694	0.89
77_D	102_E	0.691	0.89
20_F	195_L	0.686	0.88
19_I	191_A	0.678	0.88
152_L	155_M	0.677	0.88
90_S	119_L	0.676	0.88
65_A	72_A	0.676	0.88
66_Q	77_D	0.674	0.88
125_A	156_H	0.673	0.88
30_S	34_A	0.670	0.87
15_R	18_R	0.670	0.87
151_T	178_L	0.662	0.87
150_Q	179_A	0.658	0.86
25_V	46_L	0.655	0.86
37_E	41_E	0.654	0.86
57_F	131_Y	0.653	0.86
164_A	184_I	0.653	0.86
12_E	19_I	0.651	0.86
86_I	95_A	0.648	0.85
47_Q	79_I	0.645	0.85
99_L	102_E	0.645	0.85
105_T	127_Y	0.642	0.85
32_I	43_L	0.642	0.85
55_I	83_V	0.640	0.85
85_K	109_T	0.638	0.85
118_L	156_H	0.638	0.85
32_I	37_E	0.637	0.85
110_A	129_A	0.633	0.84
153_L	160_S	0.627	0.84
73_K	76_R	0.624	0.83
32_I	35_S	0.623	0.83
10_V	37_E	0.622	0.83
71_E	74_R	0.618	0.83
120_A	125_A	0.613	0.82
145_T	149_L	0.613	0.82
112_Y	203_A	0.610	0.82
121_A	158_P	0.610	0.82
64_D	71_E	0.609	0.82
66_Q	102_E	0.605	0.81
27_T	31_I	0.601	0.81
3_L	194_M	0.597	0.81
24_G	29_P	0.591	0.80
136_D	139_G	0.589	0.80
151_T	154_E	0.587	0.79
199_A	207_F	0.587	0.79
59_Q	203_A	0.586	0.79
118_L	155_M	0.585	0.79
212_N	215_F	0.584	0.79
89_T	92_G	0.582	0.79
66_Q	72_A	0.582	0.79
143_I	177_L	0.580	0.79
135_V	138_Q	0.580	0.79
19_I	195_L	0.579	0.78
76_R	80_P	0.578	0.78
83_V	106_T	0.577	0.78
68_M	71_E	0.575	0.78
89_T	98_I	0.572	0.78
169_T	172_Q	0.572	0.78
143_I	179_A	0.571	0.78
44_P	47_Q	0.570	0.77
176_C	181_C	0.569	0.77
76_R	84_V	0.567	0.77
68_M	77_D	0.565	0.77
47_Q	82_I	0.563	0.77
19_I	192_Q	0.562	0.76
65_A	77_D	0.559	0.76
109_T	165_A	0.557	0.76
16_L	22_I	0.555	0.76
4_Y	107_L	0.555	0.76
53_E	79_I	0.555	0.76
30_S	33_A	0.554	0.75
211_W	215_F	0.554	0.75
26_T	185_T	0.553	0.75
196_N	201_E	0.553	0.75
200_V	203_A	0.550	0.75
108_G	120_A	0.550	0.75
45_R	49_A	0.549	0.75
132_V	145_T	0.548	0.75
35_S	42_V	0.547	0.74
63_R	68_M	0.546	0.74
112_Y	131_Y	0.544	0.74
33_A	210_D	0.542	0.74
6_D	26_T	0.541	0.74
28_N	165_A	0.540	0.74
17_A	49_A	0.539	0.73
131_Y	168_K	0.536	0.73
59_Q	110_A	0.533	0.73
10_V	56_L	0.533	0.73
107_L	203_A	0.532	0.72
109_T	131_Y	0.532	0.72
207_F	214_A	0.531	0.72
153_L	158_P	0.530	0.72
4_Y	83_V	0.527	0.72
173_A	184_I	0.526	0.72
139_G	171_R	0.524	0.71
15_R	90_S	0.522	0.71
75_L	82_I	0.520	0.71
55_I	105_T	0.517	0.70
131_Y	203_A	0.517	0.70
72_A	75_L	0.516	0.70
32_I	214_A	0.515	0.70
176_C	211_W	0.515	0.70
17_A	22_I	0.514	0.70
117_G	153_L	0.513	0.70
57_F	110_A	0.510	0.69
83_V	105_T	0.510	0.69
10_V	13_V	0.505	0.69
132_V	164_A	0.504	0.68
197_T	200_V	0.502	0.68
73_K	99_L	0.501	0.68
192_Q	195_L	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1l6wA	6	1	100	0.033	Contact Map
1wx0A	6	0.9182	100	0.039	Contact Map
3r8rA	5	0.9591	100	0.041	Contact Map
3s1xA	6	0.9909	100	0.043	Contact Map
1vpxA	6	0.9818	100	0.045	Contact Map
3cwnA	2	0.9636	100	0.201	Contact Map
3cq0A	2	0.9636	100	0.207	Contact Map
3m16A	2	0.9636	100	0.21	Contact Map
3tkfA	2	0.9636	100	0.21	Contact Map
3hjzA	1	0.9636	100	0.215	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.