GPH - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GPH - Phosphoglycolate phosphatase

UniProt:	P32662	Sequences: MNKFEDIRGVAFDLDGTLVDSAPGLAAAVDMALYALELPVAGEERVITWIGNGADVLMERALTWARQERATQRKTMGKPPVDDDIPAEEQVRILRKLFDRYYGEVAEEGTFLFPHVADTLGALQAKGLPLGLVTNKPTPFVAPLLEALDIAKYFSVVIGGDDVQNKKPHPDPLLLVAERMGIAPQQMLFVGDSRNDIQAAKAAGCPSVGLTYGYNYGEAIDLSQPDVIYQSINDLLPALGLPHSENQESKND	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11871
Length:	252 (208)
Sequences:	27998 (21937)
Seq/√Len:	1521.1

ECOLI - GPH YNIC YIEH YRFG YIGB YFBT YJJG PGMB YQAB YIHX
BACSU - YSAA YFNB PPAX YHCW PGMB
HALSA - Q9HQE2 Q9HSS2 Q9HP74 Q9HMC4
SULSO - Q7LXL6 Q97ZU6 Q7LX46 Q97WT6 Q97X58 Q97YZ1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_R	186_Q	4.060	1.00
146_E	151_A	2.754	1.00
175_L	179_R	2.723	1.00
165_N	169_H	2.646	1.00
200_A	207_S	2.592	1.00
191_G	196_D	2.475	1.00
138_T	142_A	2.445	1.00
121_G	153_Y	2.380	1.00
9_G	182_I	2.378	1.00
129_P	155_S	2.318	1.00
7_I	206_P	2.306	1.00
117_A	121_G	2.297	1.00
35_A	97_L	2.187	1.00
131_G	156_V	2.159	1.00
175_L	178_E	2.135	1.00
138_T	162_D	2.133	1.00
12_F	130_L	2.111	1.00
201_K	226_D	2.043	1.00
230_Q	234_D	2.039	1.00
177_A	187_M	2.013	1.00
134_T	141_V	2.012	1.00
133_V	172_P	1.995	1.00
197_I	207_S	1.980	1.00
156_V	179_R	1.951	1.00
165_N	171_D	1.914	1.00
183_A	186_Q	1.901	1.00
206_P	226_D	1.831	1.00
198_Q	202_A	1.810	1.00
122_A	126_K	1.792	1.00
31_M	101_Y	1.775	1.00
124_Q	153_Y	1.774	1.00
10_V	128_L	1.760	1.00
122_A	236_L	1.729	1.00
11_A	189_F	1.719	1.00
188_L	208_V	1.694	1.00
42_G	45_R	1.693	1.00
177_A	205_C	1.677	1.00
124_Q	155_S	1.639	1.00
116_V	232_I	1.625	1.00
7_I	188_L	1.576	1.00
211_T	230_Q	1.555	1.00
189_F	200_A	1.553	1.00
130_L	154_F	1.546	1.00
177_A	184_P	1.515	1.00
11_A	176_V	1.507	1.00
11_A	133_V	1.495	1.00
9_G	180_M	1.495	1.00
142_A	151_A	1.473	1.00
113_F	212_Y	1.438	1.00
36_L	97_L	1.418	1.00
182_I	187_M	1.405	1.00
10_V	190_V	1.388	1.00
10_V	123_L	1.385	1.00
131_G	180_M	1.379	1.00
119_T	232_I	1.369	1.00
208_V	229_Y	1.364	1.00
211_T	228_I	1.339	1.00
35_A	101_Y	1.322	1.00
101_Y	104_E	1.303	1.00
194_R	198_Q	1.298	1.00
170_P	174_L	1.279	1.00
231_S	234_D	1.277	1.00
14_L	19_V	1.272	1.00
208_V	227_V	1.266	1.00
122_A	125_A	1.262	1.00
17_T	190_V	1.245	1.00
18_L	116_V	1.236	1.00
93_I	97_L	1.225	1.00
97_L	100_R	1.218	1.00
14_L	132_L	1.211	1.00
90_Q	93_I	1.209	1.00
14_L	141_V	1.207	1.00
142_A	146_E	1.204	1.00
115_H	118_D	1.188	1.00
119_T	236_L	1.188	1.00
173_L	189_F	1.184	1.00
141_V	159_G	1.183	1.00
158_I	179_R	1.168	1.00
187_M	205_C	1.126	1.00
112_L	150_I	1.122	1.00
11_A	187_M	1.121	1.00
217_G	221_D	1.116	1.00
173_L	199_A	1.107	1.00
118_D	233_N	1.103	1.00
9_G	129_P	1.099	1.00
32_A	36_L	1.099	1.00
31_M	35_A	1.093	1.00
56_V	59_E	1.088	1.00
31_M	105_V	1.085	1.00
158_I	176_V	1.077	1.00
173_L	205_C	1.071	1.00
9_G	187_M	1.055	1.00
97_L	101_Y	1.055	1.00
43_E	47_I	1.054	1.00
14_L	136_K	1.053	1.00
174_L	178_E	1.051	1.00
149_D	152_K	1.045	1.00
101_Y	105_V	1.045	1.00
133_V	176_V	1.043	1.00
121_G	125_A	1.042	1.00
124_Q	130_L	1.036	1.00
171_D	175_L	1.030	1.00
15_D	21_S	1.026	1.00
27_A	31_M	1.021	1.00
201_K	207_S	1.021	1.00
96_K	100_R	1.017	1.00
27_A	105_V	1.016	1.00
132_L	154_F	1.012	1.00
171_D	174_L	0.994	1.00
34_Y	40_V	0.988	1.00
117_A	153_Y	0.983	1.00
174_L	203_A	0.980	1.00
31_M	34_Y	0.976	1.00
107_E	143_P	0.964	1.00
27_A	30_D	0.960	1.00
176_V	180_M	0.960	1.00
206_P	227_V	0.955	1.00
163_V	175_L	0.950	1.00
100_R	104_E	0.950	1.00
199_A	203_A	0.944	1.00
15_D	136_K	0.943	1.00
189_F	205_C	0.942	1.00
115_H	231_S	0.941	1.00
120_L	154_F	0.941	1.00
143_P	147_A	0.935	1.00
197_I	225_P	0.933	1.00
156_V	180_M	0.932	1.00
138_T	159_G	0.929	1.00
9_G	131_G	0.929	1.00
30_D	34_Y	0.917	1.00
141_V	144_L	0.913	1.00
59_E	63_T	0.908	1.00
143_P	146_E	0.903	1.00
195_N	198_Q	0.898	1.00
118_D	121_G	0.896	1.00
201_K	224_Q	0.896	1.00
134_T	159_G	0.895	1.00
55_D	59_E	0.895	1.00
164_Q	171_D	0.892	1.00
112_L	117_A	0.890	1.00
11_A	205_C	0.890	1.00
234_D	237_P	0.886	1.00
52_N	56_V	0.886	1.00
113_F	210_L	0.886	1.00
113_F	116_V	0.881	1.00
229_Y	235_L	0.874	1.00
174_L	184_P	0.870	1.00
27_A	109_G	0.868	1.00
92_R	96_K	0.865	1.00
207_S	226_D	0.860	1.00
173_L	191_G	0.860	1.00
11_A	180_M	0.857	1.00
115_H	233_N	0.856	1.00
121_G	152_K	0.855	1.00
136_K	141_V	0.853	1.00
138_T	161_D	0.853	1.00
217_G	230_Q	0.846	1.00
53_G	56_V	0.842	1.00
131_G	176_V	0.841	1.00
98_F	102_Y	0.839	1.00
158_I	175_L	0.834	1.00
95_R	99_D	0.834	1.00
15_D	134_T	0.830	1.00
26_A	30_D	0.822	1.00
188_L	206_P	0.821	1.00
209_G	228_I	0.820	1.00
14_L	144_L	0.815	1.00
10_V	188_L	0.812	1.00
123_L	128_L	0.809	1.00
218_E	221_D	0.797	1.00
59_E	91_V	0.797	1.00
120_L	153_Y	0.796	1.00
8_R	128_L	0.793	1.00
123_L	130_L	0.793	1.00
52_N	60_R	0.793	1.00
19_V	144_L	0.786	1.00
7_I	128_L	0.785	1.00
197_I	209_G	0.782	1.00
184_P	205_C	0.779	1.00
11_A	131_G	0.769	1.00
208_V	235_L	0.768	1.00
15_D	192_D	0.768	1.00
190_V	208_V	0.768	1.00
33_L	38_L	0.762	1.00
105_V	108_E	0.759	1.00
44_E	48_T	0.757	1.00
159_G	162_D	0.755	1.00
15_D	144_L	0.755	1.00
8_R	129_P	0.754	1.00
212_Y	232_I	0.753	1.00
209_G	220_I	0.751	1.00
102_Y	106_A	0.749	1.00
130_L	153_Y	0.747	1.00
56_V	60_R	0.747	1.00
117_A	149_D	0.747	1.00
19_V	148_L	0.745	1.00
63_T	66_R	0.732	1.00
182_I	186_Q	0.729	1.00
117_A	152_K	0.723	1.00
210_L	232_I	0.719	1.00
96_K	99_D	0.707	1.00
135_N	166_K	0.707	1.00
7_I	186_Q	0.706	1.00
94_L	98_F	0.699	1.00
141_V	157_V	0.695	1.00
30_D	43_E	0.693	1.00
112_L	148_L	0.693	1.00
16_G	22_A	0.690	1.00
28_A	32_A	0.689	1.00
60_R	63_T	0.686	1.00
118_D	122_A	0.684	1.00
184_P	187_M	0.679	1.00
198_Q	201_K	0.674	1.00
60_R	64_W	0.674	1.00
36_L	93_I	0.673	1.00
47_I	50_I	0.673	1.00
145_L	151_A	0.669	1.00
190_V	235_L	0.666	1.00
17_T	196_D	0.661	1.00
133_V	189_F	0.661	1.00
172_P	176_V	0.659	1.00
162_D	179_R	0.657	1.00
34_Y	39_P	0.654	1.00
232_I	236_L	0.654	1.00
54_A	57_L	0.650	1.00
170_P	202_A	0.647	1.00
189_F	196_D	0.646	1.00
28_A	101_Y	0.645	1.00
129_P	182_I	0.642	1.00
172_P	199_A	0.639	1.00
229_Y	232_I	0.638	1.00
30_D	40_V	0.638	1.00
158_I	172_P	0.636	1.00
156_V	176_V	0.634	1.00
94_L	97_L	0.634	1.00
8_R	182_I	0.630	1.00
142_A	157_V	0.628	1.00
173_L	196_D	0.628	1.00
25_L	98_F	0.625	1.00
20_D	111_F	0.622	1.00
60_R	65_A	0.619	1.00
57_L	60_R	0.617	1.00
177_A	182_I	0.617	1.00
23_P	111_F	0.614	1.00
45_R	48_T	0.613	1.00
19_V	110_T	0.611	1.00
116_V	120_L	0.610	1.00
103_G	139_P	0.609	1.00
189_F	199_A	0.607	1.00
130_L	155_S	0.602	1.00
160_G	172_P	0.601	1.00
154_F	157_V	0.601	1.00
89_E	93_I	0.600	1.00
115_H	212_Y	0.596	1.00
137_P	140_F	0.594	1.00
44_E	47_I	0.592	1.00
209_G	225_P	0.592	1.00
93_I	96_K	0.591	1.00
99_D	103_G	0.590	1.00
163_V	172_P	0.590	1.00
121_G	124_Q	0.589	1.00
174_L	177_A	0.587	1.00
177_A	203_A	0.585	1.00
21_S	136_K	0.584	1.00
32_A	97_L	0.584	1.00
135_N	168_P	0.583	1.00
124_Q	152_K	0.581	1.00
216_Y	219_A	0.581	1.00
107_E	147_A	0.579	1.00
17_T	210_L	0.579	1.00
62_L	66_R	0.577	1.00
229_Y	236_L	0.576	1.00
198_Q	223_S	0.576	1.00
36_L	94_L	0.573	1.00
233_N	236_L	0.573	1.00
20_D	113_F	0.570	1.00
112_L	116_V	0.569	1.00
195_N	199_A	0.569	1.00
105_V	109_G	0.569	1.00
116_V	119_T	0.566	1.00
100_R	103_G	0.565	1.00
114_P	233_N	0.565	1.00
135_N	195_N	0.562	1.00
133_V	158_I	0.558	1.00
61_A	64_W	0.555	1.00
141_V	145_L	0.555	1.00
23_P	27_A	0.554	1.00
24_G	110_T	0.554	1.00
115_H	119_T	0.553	1.00
25_L	29_V	0.550	1.00
12_F	119_T	0.547	1.00
54_A	58_M	0.547	1.00
26_A	46_V	0.542	1.00
114_P	231_S	0.540	1.00
62_L	65_A	0.532	1.00
146_E	152_K	0.531	1.00
136_K	140_F	0.528	1.00
95_R	98_F	0.528	1.00
119_T	190_V	0.524	1.00
20_D	23_P	0.523	1.00
136_K	191_G	0.522	1.00
11_A	173_L	0.522	1.00
135_N	160_G	0.522	1.00
25_L	136_K	0.521	1.00
173_L	200_A	0.520	1.00
18_L	132_L	0.520	1.00
119_T	122_A	0.518	1.00
132_L	145_L	0.513	1.00
46_V	50_I	0.511	1.00
150_I	153_Y	0.510	1.00
10_V	130_L	0.507	1.00
18_L	120_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3iruA	4	0.9683	100	0.327	Contact Map
1swvA	2	0.9167	100	0.328	Contact Map
3s6jA	2	0.873	100	0.332	Contact Map
1te2A	2	0.8611	100	0.332	Contact Map
4eekA	2	0.8849	100	0.333	Contact Map
4uw9A	1	0.8452	100	0.339	Contact Map
3d6jA	1	0.8333	100	0.342	Contact Map
3l5kA	1	0.881	100	0.349	Contact Map
3mc1A	2	0.8611	100	0.351	Contact Map
3sd7A	1	0.8492	100	0.351	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0084 seconds.