MOBA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MOBA - Molybdenum cofactor guanylyltransferase

UniProt:	P32173	Sequences: MNLMTTITGVVLAGGKARRMGGVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVNVNTPEELARWQEKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11829
Length:	194 (179)
Sequences:	4733 (3847)
Seq/√Len:	287.6

ECOLI - MOBA MOCA
BACSU - MOBA PUCB
HALSA - Q9HR78
SULSO - Q7LXN3 Q97W15

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_K	41_D	5.688	1.00
20_M	28_L	3.276	1.00
10_V	86_V	3.269	1.00
26_G	100_C	3.234	1.00
34_P	37_Q	3.223	1.00
104_Y	190_W	2.569	1.00
28_L	187_L	2.430	1.00
9_G	43_L	2.353	1.00
9_G	47_L	2.235	1.00
96_L	110_A	2.227	1.00
49_H	67_K	2.153	1.00
33_K	38_H	2.149	1.00
88_Q	147_L	2.140	1.00
90_E	95_F	2.056	1.00
33_K	37_Q	2.031	1.00
156_R	159_V	2.008	1.00
8_T	92_G	1.987	1.00
8_T	49_H	1.980	1.00
10_V	95_F	1.923	1.00
122_V	164_A	1.855	1.00
8_T	90_E	1.823	1.00
183_T	186_E	1.785	1.00
94_W	137_L	1.747	1.00
83_M	97_F	1.710	1.00
87_M	95_F	1.699	1.00
131_D	168_A	1.672	1.00
71_D	81_A	1.642	1.00
37_Q	41_D	1.630	1.00
43_L	98_C	1.556	1.00
84_L	88_Q	1.552	1.00
13_A	52_V	1.550	1.00
20_M	184_P	1.527	1.00
99_P	102_T	1.517	1.00
94_W	139_N	1.499	1.00
11_V	40_A	1.483	1.00
181_V	190_W	1.474	1.00
23_V	28_L	1.465	1.00
77_P	155_R	1.456	1.00
121_P	165_G	1.430	1.00
30_L	35_L	1.415	1.00
53_N	86_V	1.391	1.00
179_V	190_W	1.369	1.00
83_M	157_V	1.356	1.00
51_V	69_I	1.353	1.00
102_T	135_I	1.353	1.00
40_A	66_L	1.317	1.00
109_L	177_A	1.309	1.00
145_L	164_A	1.308	1.00
105_I	135_I	1.298	1.00
30_L	190_W	1.288	1.00
23_V	184_P	1.280	1.00
29_E	32_G	1.278	1.00
149_Y	160_F	1.272	1.00
106_P	109_L	1.263	1.00
84_L	147_L	1.257	1.00
126_H	129_E	1.255	1.00
98_C	105_I	1.253	1.00
37_Q	64_S	1.250	1.00
17_A	23_V	1.243	1.00
145_L	163_L	1.219	1.00
69_I	85_S	1.215	1.00
142_I	145_L	1.210	1.00
96_L	137_L	1.190	1.00
10_V	97_F	1.188	1.00
77_P	81_A	1.188	1.00
73_L	77_P	1.181	1.00
142_I	164_A	1.181	1.00
7_I	114_N	1.172	1.00
122_V	125_V	1.167	1.00
31_N	38_H	1.165	1.00
154_E	159_V	1.149	1.00
181_V	187_L	1.144	1.00
126_H	170_D	1.141	1.00
98_C	110_A	1.132	1.00
17_A	26_G	1.123	1.00
35_L	181_V	1.118	1.00
126_H	131_D	1.115	1.00
121_P	139_N	1.105	1.00
8_T	51_V	1.101	1.00
62_Q	70_E	1.081	1.00
160_F	164_A	1.081	1.00
122_V	161_M	1.062	1.00
11_V	39_V	1.054	1.00
35_L	39_V	1.053	1.00
29_E	34_P	1.050	1.00
24_D	27_L	1.050	1.00
149_Y	154_E	1.050	1.00
11_V	36_W	1.049	1.00
121_P	141_A	1.047	1.00
140_R	143_E	1.046	1.00
106_P	177_A	1.032	1.00
7_I	94_W	1.032	1.00
40_A	50_V	1.015	1.00
16_K	75_D	1.001	1.00
29_E	33_K	0.996	1.00
116_Q	167_H	0.993	1.00
159_V	162_R	0.983	1.00
54_A	68_V	0.982	1.00
34_P	38_H	0.980	1.00
145_L	160_F	0.978	1.00
120_A	167_H	0.964	1.00
38_H	42_A	0.963	1.00
20_M	23_V	0.958	1.00
147_L	151_Q	0.956	1.00
39_V	42_A	0.944	1.00
149_Y	159_V	0.943	1.00
46_Q	111_A	0.937	1.00
93_E	140_R	0.936	1.00
52_V	66_L	0.915	1.00
45_T	107_P	0.915	1.00
113_L	137_L	0.915	1.00
73_L	84_L	0.911	1.00
47_L	96_L	0.909	1.00
114_N	137_L	0.904	1.00
186_E	189_R	0.901	1.00
148_E	152_A	0.900	1.00
10_V	53_N	0.896	1.00
81_A	85_S	0.896	1.00
71_D	85_S	0.892	1.00
99_P	135_I	0.886	1.00
179_V	189_R	0.881	1.00
104_Y	179_V	0.872	1.00
14_G	82_G	0.870	1.00
124_W	131_D	0.869	1.00
138_V	146_L	0.867	1.00
17_A	24_D	0.866	1.00
77_P	153_G	0.865	1.00
67_K	89_Q	0.858	1.00
87_M	143_E	0.857	1.00
126_H	168_A	0.857	1.00
145_L	148_E	0.846	1.00
51_V	89_Q	0.841	1.00
127_D	132_H	0.839	1.00
78_G	81_A	0.837	1.00
80_L	146_L	0.826	1.00
54_A	70_E	0.820	1.00
14_G	79_P	0.819	1.00
81_A	84_L	0.815	1.00
59_E	62_Q	0.807	0.99
57_H	60_I	0.807	0.99
11_V	43_L	0.806	0.99
99_P	138_V	0.805	0.99
65_G	68_V	0.803	0.99
158_M	162_R	0.802	0.99
49_H	53_N	0.798	0.99
124_W	168_A	0.797	0.99
35_L	100_C	0.796	0.99
79_P	82_G	0.788	0.99
42_A	107_P	0.777	0.99
71_D	74_A	0.772	0.99
43_L	46_Q	0.770	0.99
9_G	39_V	0.770	0.99
17_A	187_L	0.768	0.99
60_I	63_A	0.761	0.99
90_E	140_R	0.757	0.99
20_M	181_V	0.756	0.99
93_E	139_N	0.754	0.99
146_L	160_F	0.753	0.99
166_G	170_D	0.752	0.99
185_E	189_R	0.738	0.99
51_V	90_E	0.734	0.99
72_S	88_Q	0.733	0.99
124_W	136_A	0.728	0.99
136_A	161_M	0.726	0.99
55_N	74_A	0.726	0.99
95_F	143_E	0.723	0.99
185_E	188_A	0.715	0.99
127_D	130_R	0.714	0.99
184_P	188_A	0.713	0.99
39_V	98_C	0.710	0.99
17_A	20_M	0.707	0.99
36_W	40_A	0.704	0.99
133_P	136_A	0.704	0.99
15_G	19_R	0.703	0.99
69_I	86_V	0.701	0.99
125_V	171_F	0.700	0.99
80_L	160_F	0.697	0.98
24_D	56_R	0.696	0.98
171_F	178_F	0.696	0.98
46_Q	110_A	0.685	0.98
44_M	65_G	0.679	0.98
10_V	51_V	0.671	0.98
69_I	89_Q	0.670	0.98
40_A	64_S	0.668	0.98
71_D	82_G	0.662	0.98
144_P	147_L	0.661	0.98
14_G	99_P	0.659	0.98
120_A	139_N	0.659	0.98
10_V	90_E	0.657	0.98
109_L	113_L	0.656	0.98
122_V	166_G	0.656	0.98
107_P	111_A	0.655	0.98
97_F	138_V	0.650	0.98
49_H	92_G	0.645	0.98
104_Y	181_V	0.633	0.97
124_W	166_G	0.632	0.97
47_L	110_A	0.632	0.97
28_L	184_P	0.628	0.97
27_L	64_S	0.624	0.97
30_L	38_H	0.623	0.97
31_N	190_W	0.623	0.97
96_L	114_N	0.623	0.97
167_H	170_D	0.622	0.97
148_E	151_Q	0.621	0.97
26_G	36_W	0.620	0.97
119_D	139_N	0.617	0.97
29_E	187_L	0.615	0.97
117_R	120_A	0.614	0.97
161_M	166_G	0.611	0.97
86_V	95_F	0.610	0.97
35_L	190_W	0.607	0.96
80_L	84_L	0.607	0.96
112_R	116_Q	0.604	0.96
118_K	121_P	0.597	0.96
83_M	99_P	0.595	0.96
73_L	81_A	0.594	0.96
72_S	84_L	0.594	0.96
152_A	163_L	0.593	0.96
36_W	52_V	0.592	0.96
42_A	46_Q	0.592	0.96
53_N	69_I	0.590	0.96
131_D	158_M	0.585	0.96
88_Q	143_E	0.584	0.96
79_P	132_H	0.582	0.95
120_A	165_G	0.580	0.95
35_L	187_L	0.571	0.95
20_M	24_D	0.565	0.95
111_A	115_H	0.559	0.94
134_T	157_V	0.555	0.94
24_D	55_N	0.555	0.94
121_P	166_G	0.554	0.94
128_G	133_P	0.553	0.94
20_M	186_E	0.550	0.94
55_N	78_G	0.548	0.94
27_L	61_Y	0.548	0.94
56_R	60_I	0.547	0.94
149_Y	163_L	0.544	0.94
102_T	134_T	0.543	0.94
14_G	134_T	0.541	0.93
55_N	61_Y	0.541	0.93
167_H	171_F	0.540	0.93
124_W	161_M	0.539	0.93
7_I	137_L	0.537	0.93
83_M	138_V	0.537	0.93
144_P	148_E	0.536	0.93
95_F	140_R	0.533	0.93
40_A	44_M	0.530	0.93
130_R	135_I	0.530	0.93
178_F	182_N	0.529	0.93
49_H	91_A	0.528	0.93
111_A	114_N	0.526	0.92
56_R	61_Y	0.525	0.92
79_P	182_N	0.525	0.92
53_N	82_G	0.523	0.92
134_T	138_V	0.522	0.92
117_R	167_H	0.522	0.92
41_D	45_T	0.522	0.92
140_R	144_P	0.519	0.92
20_M	183_T	0.518	0.92
122_V	138_V	0.518	0.92
80_L	157_V	0.515	0.92
53_N	56_R	0.511	0.91
127_D	171_F	0.510	0.91
11_V	50_V	0.504	0.91
9_G	96_L	0.503	0.91
20_M	187_L	0.503	0.91
26_G	35_L	0.500	0.90
104_Y	176_D	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1e5kA	1	0.9691	100	0.234	Contact Map
2e8bA	1	0.9021	100	0.319	Contact Map
3ngwA	2	0.9278	100	0.335	Contact Map
2weeA	1	0.9485	100	0.351	Contact Map
2wawA	1	0.9485	100	0.365	Contact Map
3d5nA	2	0.8866	100	0.394	Contact Map
3rsbA	1	0.8454	99.9	0.495	Contact Map
2xmeA	3	0.9124	99.9	0.496	Contact Map
2px7A	2	0.8918	99.9	0.499	Contact Map
4mndA	2	0.933	99.9	0.505	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.