RHAM - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RHAM - L-rhamnose mutarotase

UniProt:	P32156	Sequences: MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTDVMPANPDNSPVSSELQEVFYLP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11865
Length:	104 (101)
Sequences:	879 (578)
Seq/√Len:	57.5

ECOLI - RHAM
BACSU - RHAM

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_N	57_E	3.600	1.00
72_V	75_R	2.919	1.00
19_Q	23_N	2.400	1.00
5_A	53_F	2.385	1.00
31_A	35_S	2.369	1.00
40_N	55_M	2.330	1.00
25_I	30_E	2.279	1.00
3_R	99_E	2.222	1.00
10_V	15_H	1.978	1.00
87_N	91_S	1.956	1.00
9_Q	85_P	1.915	1.00
7_V	51_L	1.820	0.99
17_E	20_R	1.727	0.99
21_R	83_V	1.727	0.99
6_F	54_A	1.709	0.99
28_E	72_V	1.701	0.99
31_A	34_K	1.666	0.99
39_H	59_E	1.636	0.99
15_H	50_N	1.629	0.99
42_A	55_M	1.588	0.98
11_N	85_P	1.557	0.98
70_T	73_C	1.487	0.98
3_R	42_A	1.474	0.98
99_E	102_Y	1.453	0.97
58_I	64_W	1.450	0.97
15_H	47_K	1.385	0.96
40_N	102_Y	1.356	0.96
7_V	46_D	1.318	0.95
20_R	24_P	1.293	0.95
36_H	66_A	1.292	0.95
74_Q	78_K	1.281	0.94
42_A	102_Y	1.280	0.94
9_Q	51_L	1.264	0.94
21_R	80_M	1.262	0.94
26_W	72_V	1.254	0.94
34_K	39_H	1.252	0.94
19_Q	98_Q	1.238	0.93
3_R	57_E	1.235	0.93
36_H	67_V	1.229	0.93
47_K	98_Q	1.229	0.93
33_L	38_A	1.220	0.93
17_E	21_R	1.211	0.93
47_K	50_N	1.181	0.92
11_N	14_A	1.173	0.91
73_C	77_W	1.163	0.91
3_R	102_Y	1.160	0.91
46_D	49_R	1.146	0.90
7_V	49_R	1.114	0.89
32_V	67_V	1.113	0.89
66_A	69_S	1.113	0.89
30_E	101_F	1.109	0.89
45_L	52_L	1.109	0.89
52_L	100_V	1.084	0.88
78_K	90_N	1.077	0.87
21_R	79_Y	1.075	0.87
30_E	103_L	1.044	0.86
32_V	70_T	0.989	0.82
38_A	56_V	0.987	0.82
78_K	86_A	0.985	0.82
33_L	72_V	0.980	0.82
67_V	73_C	0.969	0.81
32_V	36_H	0.960	0.80
33_L	67_V	0.944	0.79
65_N	68_A	0.941	0.79
34_K	59_E	0.931	0.78
5_A	43_I	0.929	0.78
19_Q	47_K	0.920	0.78
58_I	62_E	0.915	0.77
7_V	53_F	0.912	0.77
46_D	51_L	0.902	0.76
61_E	74_Q	0.893	0.75
44_Y	57_E	0.855	0.72
2_I	96_E	0.847	0.72
36_H	70_T	0.832	0.70
4_K	61_E	0.814	0.68
4_K	64_W	0.810	0.68
56_V	64_W	0.809	0.68
4_K	56_V	0.785	0.66
38_A	67_V	0.770	0.64
35_S	70_T	0.763	0.63
35_S	66_A	0.762	0.63
19_Q	100_V	0.756	0.63
65_N	69_S	0.756	0.63
14_A	83_V	0.755	0.63
20_R	65_N	0.741	0.61
32_V	35_S	0.740	0.61
32_V	73_C	0.740	0.61
4_K	44_Y	0.722	0.59
44_Y	99_E	0.717	0.59
60_S	65_N	0.716	0.59
56_V	70_T	0.716	0.59
6_F	56_V	0.714	0.58
80_M	83_V	0.713	0.58
42_A	57_E	0.702	0.57
46_D	50_N	0.701	0.57
78_K	81_T	0.689	0.56
3_R	55_M	0.686	0.55
21_R	52_L	0.684	0.55
33_L	36_H	0.683	0.55
25_I	29_L	0.674	0.54
58_I	63_R	0.662	0.53
22_H	76_W	0.662	0.53
39_H	103_L	0.660	0.52
46_D	89_D	0.657	0.52
29_L	32_V	0.652	0.52
61_E	65_N	0.650	0.51
3_R	44_Y	0.637	0.50
33_L	77_W	0.635	0.50
69_S	74_Q	0.633	0.49
34_K	103_L	0.625	0.49
71_D	95_S	0.624	0.48
5_A	38_A	0.619	0.48
41_Y	101_F	0.619	0.48
4_K	58_I	0.613	0.47
74_Q	77_W	0.610	0.47
62_E	66_A	0.609	0.47
39_H	102_Y	0.606	0.47
57_E	99_E	0.604	0.46
36_H	63_R	0.599	0.46
58_I	94_S	0.594	0.45
2_I	62_E	0.587	0.44
79_Y	83_V	0.584	0.44
25_I	103_L	0.576	0.43
54_A	73_C	0.574	0.43
59_E	63_R	0.571	0.43
36_H	58_I	0.569	0.43
7_V	95_S	0.568	0.42
36_H	73_C	0.566	0.42
2_I	58_I	0.565	0.42
57_E	102_Y	0.558	0.41
15_H	98_Q	0.553	0.41
64_W	73_C	0.551	0.41
37_G	80_M	0.548	0.40
92_P	96_E	0.541	0.40
3_R	40_N	0.541	0.40
44_Y	55_M	0.540	0.39
33_L	56_V	0.540	0.39
8_M	93_V	0.535	0.39
38_A	43_I	0.534	0.39
15_H	19_Q	0.533	0.39
36_H	56_V	0.531	0.38
45_L	50_N	0.531	0.38
89_D	93_V	0.530	0.38
9_Q	50_N	0.530	0.38
8_M	80_M	0.529	0.38
54_A	83_V	0.520	0.37
3_R	58_I	0.519	0.37
27_P	31_A	0.519	0.37
29_L	67_V	0.517	0.37
81_T	85_P	0.516	0.37
24_P	69_S	0.510	0.36
77_W	92_P	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qlwA	3	1	100	0.131	Contact Map
1x8dA	2	1	100	0.134	Contact Map
4dpoA	2	0.8942	96.3	0.844	Contact Map
4dn9A	3	0.9231	95.5	0.854	Contact Map
4hl9A	2	0.8942	95.2	0.856	Contact Map
1y0hA	2	0.9231	94.7	0.861	Contact Map
1x7vA	5	0.8942	94.3	0.864	Contact Map
3gz7A	2	0.9038	93.5	0.868	Contact Map
4fvcA	1	0.8269	93.1	0.87	Contact Map
2gffA	2	0.9327	93	0.87	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.