MOBB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MOBB - Molybdopterin-guanine dinucleotide biosynthesis adapter protein

UniProt:	P32125	Sequences: MAGKTMIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSYELRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11828
Length:	175 (157)
Sequences:	1396 (1011)
Seq/√Len:	80.7

ECOLI - MOBB
BACSU - MOBB
HALSA - Q9HR77
SULSO - Q7LXN5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_K	59_E	6.190	1.00
40_L	60_L	4.316	1.00
16_S	55_K	3.723	1.00
158_D	161_G	3.529	1.00
32_C	66_A	3.452	1.00
39_G	102_L	3.160	1.00
34_R	164_D	2.942	1.00
75_R	81_E	2.629	1.00
14_A	18_T	2.523	1.00
61_R	81_E	2.444	1.00
39_G	97_M	2.416	1.00
30_A	160_E	2.332	1.00
30_A	34_R	2.199	1.00
50_V	79_M	2.180	1.00
24_L	60_L	2.127	1.00
11_A	115_I	2.076	1.00
58_Y	62_K	2.050	1.00
28_I	40_L	1.914	1.00
34_R	167_V	1.898	1.00
44_T	48_M	1.876	1.00
36_I	167_V	1.874	1.00
9_L	94_A	1.830	1.00
67_Q	80_T	1.799	1.00
107_V	115_I	1.779	1.00
27_L	162_L	1.768	1.00
48_M	72_S	1.690	1.00
11_A	107_V	1.688	1.00
118_I	140_A	1.651	1.00
30_A	163_A	1.637	1.00
89_D	92_F	1.625	1.00
30_A	159_V	1.622	1.00
57_S	70_V	1.542	0.99
69_I	78_L	1.497	0.99
18_T	120_L	1.451	0.99
122_R	156_I	1.434	0.99
23_L	162_L	1.388	0.99
51_D	54_G	1.383	0.99
7_I	105_I	1.381	0.99
154_L	165_F	1.373	0.99
27_L	163_A	1.307	0.98
24_L	29_P	1.292	0.98
30_A	33_A	1.271	0.98
12_F	27_L	1.265	0.98
51_D	58_Y	1.252	0.98
152_A	165_F	1.239	0.98
47_D	74_Q	1.234	0.97
22_T	159_V	1.211	0.97
111_K	117_K	1.205	0.97
48_M	79_M	1.201	0.97
110_F	113_E	1.197	0.97
94_A	105_I	1.196	0.97
71_A	93_L	1.169	0.96
155_D	158_D	1.164	0.96
160_E	164_D	1.162	0.96
48_M	77_A	1.156	0.96
48_M	70_V	1.140	0.96
41_I	105_I	1.103	0.95
123_D	145_V	1.098	0.95
69_I	93_L	1.098	0.95
76_W	80_T	1.096	0.95
10_L	169_W	1.089	0.95
36_I	104_L	1.080	0.95
41_I	90_L	1.078	0.94
24_L	106_L	1.069	0.94
25_K	63_A	1.066	0.94
40_L	65_A	1.064	0.94
38_P	104_L	1.053	0.94
144_D	157_N	1.046	0.94
119_V	133_V	1.045	0.94
48_M	51_D	1.042	0.93
24_L	28_I	1.039	0.93
119_V	132_L	1.000	0.92
17_G	55_K	0.984	0.91
50_V	77_A	0.982	0.91
31_L	167_V	0.980	0.91
121_F	145_V	0.975	0.91
10_L	106_L	0.967	0.91
73_Q	87_E	0.958	0.90
25_K	62_K	0.946	0.90
14_A	68_T	0.941	0.89
12_F	118_I	0.935	0.89
154_L	162_L	0.933	0.89
9_L	105_I	0.932	0.89
159_V	162_L	0.924	0.88
9_L	115_I	0.922	0.88
141_V	149_L	0.920	0.88
70_V	77_A	0.914	0.88
44_T	72_S	0.906	0.87
15_W	111_K	0.904	0.87
10_L	166_V	0.896	0.87
15_W	117_K	0.884	0.86
61_R	75_R	0.880	0.86
49_D	75_R	0.874	0.86
30_A	164_D	0.870	0.85
54_G	58_Y	0.848	0.84
53_P	62_K	0.843	0.83
14_A	109_G	0.840	0.83
10_L	118_I	0.829	0.82
27_L	31_L	0.829	0.82
155_D	161_G	0.827	0.82
57_S	60_L	0.817	0.81
143_S	146_P	0.815	0.81
26_K	159_V	0.812	0.81
144_D	156_I	0.809	0.81
142_A	154_L	0.808	0.81
148_N	168_E	0.794	0.80
140_A	154_L	0.792	0.79
45_H	57_S	0.789	0.79
97_M	102_L	0.783	0.79
119_V	138_V	0.781	0.78
43_H	111_K	0.777	0.78
8_P	104_L	0.776	0.78
164_D	168_E	0.774	0.78
23_L	118_I	0.773	0.78
91_Q	113_E	0.773	0.78
45_H	71_A	0.773	0.78
31_L	106_L	0.772	0.78
149_L	153_L	0.771	0.78
142_A	156_I	0.771	0.78
39_G	60_L	0.766	0.77
67_Q	96_R	0.765	0.77
44_T	49_D	0.751	0.76
142_A	155_D	0.739	0.75
12_F	132_L	0.734	0.74
51_D	55_K	0.734	0.74
14_A	60_L	0.732	0.74
44_T	60_L	0.730	0.74
134_I	138_V	0.725	0.73
82_T	87_E	0.721	0.73
161_G	164_D	0.719	0.72
70_V	75_R	0.719	0.72
26_K	157_N	0.713	0.72
148_N	152_A	0.712	0.72
43_H	109_G	0.709	0.71
13_A	119_V	0.708	0.71
150_D	153_L	0.707	0.71
60_L	63_A	0.707	0.71
10_L	139_I	0.705	0.71
154_L	159_V	0.704	0.71
130_E	157_N	0.702	0.71
36_I	103_D	0.700	0.70
134_I	168_E	0.686	0.69
93_L	110_F	0.685	0.69
118_I	142_A	0.685	0.69
92_F	95_S	0.684	0.69
143_S	147_L	0.683	0.69
16_S	24_L	0.680	0.68
31_L	163_A	0.670	0.67
7_I	14_A	0.669	0.67
43_H	72_S	0.668	0.67
44_T	70_V	0.664	0.66
122_R	144_D	0.659	0.66
119_V	144_D	0.658	0.66
39_G	67_Q	0.650	0.65
149_L	152_A	0.650	0.65
14_A	120_L	0.646	0.64
17_G	24_L	0.645	0.64
142_A	162_L	0.645	0.64
121_F	126_G	0.643	0.64
97_M	101_K	0.641	0.64
159_V	163_A	0.640	0.64
43_H	56_D	0.639	0.63
17_G	29_P	0.638	0.63
97_M	105_I	0.637	0.63
90_L	113_E	0.636	0.63
130_E	135_D	0.630	0.62
71_A	87_E	0.629	0.62
56_D	111_K	0.628	0.62
67_Q	100_S	0.625	0.62
11_A	113_E	0.620	0.61
12_F	26_K	0.618	0.61
67_Q	102_L	0.612	0.60
67_Q	78_L	0.610	0.60
48_M	52_K	0.603	0.59
107_V	110_F	0.603	0.59
14_A	19_G	0.602	0.59
14_A	20_K	0.596	0.58
10_L	24_L	0.594	0.58
51_D	77_A	0.587	0.57
133_V	138_V	0.584	0.57
119_V	125_A	0.583	0.56
26_K	74_Q	0.583	0.56
59_E	62_K	0.578	0.56
159_V	166_V	0.577	0.56
89_D	113_E	0.577	0.56
130_E	141_V	0.577	0.56
54_G	152_A	0.577	0.56
29_P	40_L	0.575	0.55
119_V	131_E	0.575	0.55
44_T	73_Q	0.570	0.55
47_D	73_Q	0.569	0.55
41_I	69_I	0.569	0.55
31_L	36_I	0.566	0.54
37_R	66_A	0.566	0.54
12_F	24_L	0.565	0.54
51_D	79_M	0.565	0.54
80_T	96_R	0.565	0.54
73_Q	102_L	0.563	0.54
76_W	82_T	0.563	0.54
69_I	97_M	0.563	0.54
112_H	131_E	0.557	0.53
23_L	140_A	0.557	0.53
53_P	58_Y	0.557	0.53
44_T	74_Q	0.552	0.52
29_P	32_C	0.552	0.52
22_T	31_L	0.551	0.52
80_T	101_K	0.551	0.52
53_P	126_G	0.549	0.52
16_S	120_L	0.548	0.52
84_D	136_R	0.547	0.52
38_P	83_P	0.547	0.52
27_L	159_V	0.546	0.52
20_K	108_E	0.545	0.52
93_L	97_M	0.542	0.51
71_A	82_T	0.541	0.51
95_S	168_E	0.540	0.51
143_S	153_L	0.538	0.51
41_I	93_L	0.535	0.50
82_T	88_L	0.533	0.50
28_I	60_L	0.530	0.50
164_D	167_V	0.528	0.49
30_A	158_D	0.528	0.49
44_T	47_D	0.527	0.49
130_E	133_V	0.524	0.49
11_A	138_V	0.523	0.49
34_R	163_A	0.522	0.49
132_L	138_V	0.522	0.49
90_L	97_M	0.522	0.49
150_D	168_E	0.520	0.48
153_L	164_D	0.519	0.48
28_I	63_A	0.514	0.48
154_L	166_V	0.512	0.47
43_H	117_K	0.512	0.47
57_S	104_L	0.511	0.47
51_D	70_V	0.507	0.47
62_K	120_L	0.500	0.46

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4nkrA	2	0.9086	100	0.382	Contact Map
1xjcA	2	0.8171	100	0.422	Contact Map
1np6A	2	0.9714	99.9	0.608	Contact Map
2f1rA	2	0.8571	99.7	0.686	Contact Map
4ehxA	1	0.9429	99.3	0.757	Contact Map
2wsmA	2	0.8743	99	0.787	Contact Map
2hf9A	2	0.8971	98.8	0.802	Contact Map
4a0gA	2	0.8971	98.6	0.81	Contact Map
3fgnA	2	0.9371	98.5	0.819	Contact Map
3of5A	2	0.9086	98.4	0.821	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.