YIEK - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YIEK - Uncharacterized protein YieK

UniProt:	P31470	Sequences: MKLIITEDYQEMSRVAAHHLLGYMSKTRRVNLAITAGSTPKGMYEYLTTLVKGKPWYDNCYFYNFDEIPFRGKEGEGVTITNLRNLFFTPAGIKEENIQKLTIDNYREHDQKLAREGGLDLVVLGLGADGHFCGNLPNTTHFHEQTVEFPIQGEMVDIVAHGELGGDFSLVPDSYVTMGPKSIMAAKNLLIIVSGAGKAQALKNVLQGPVTEDVPASVLQLHPSLMVIADKAAAAELALG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11728
Length:	240 (216)
Sequences:	5198 (3739)
Seq/√Len:	254.4

ECOLI - YIEK NAGB AGAI
BACSU - NAGB GAMA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
81_T	85_N	3.595	1.00
196_A	232_A	2.809	1.00
7_E	231_K	2.720	1.00
105_N	108_E	2.715	1.00
128_A	197_G	2.650	1.00
188_N	224_S	2.610	1.00
46_Y	49_T	2.489	1.00
8_D	11_E	2.452	1.00
202_L	229_A	2.427	1.00
84_R	89_T	2.274	1.00
200_Q	204_N	2.177	1.00
101_L	176_V	2.175	1.00
111_Q	115_R	2.174	1.00
23_Y	30_V	2.111	1.00
56_W	92_G	2.051	1.00
229_A	234_A	2.048	1.00
6_T	15_V	2.025	1.00
13_S	42_G	1.994	1.00
73_K	80_I	1.988	1.00
23_Y	188_N	1.977	1.00
167_D	170_L	1.946	1.00
85_N	89_T	1.922	1.00
120_D	187_K	1.890	1.00
20_L	43_M	1.887	1.00
145_Q	185_A	1.875	1.00
12_M	194_S	1.868	1.00
14_R	46_Y	1.863	1.00
122_V	186_A	1.856	1.00
62_F	88_F	1.829	1.00
18_H	50_L	1.796	1.00
80_I	84_R	1.776	1.00
150_P	174_S	1.767	1.00
203_K	207_Q	1.758	1.00
21_L	50_L	1.740	1.00
41_K	86_L	1.736	1.00
204_N	214_V	1.711	1.00
61_Y	99_Q	1.700	1.00
29_R	61_Y	1.697	1.00
99_Q	112_K	1.651	1.00
184_M	218_V	1.605	1.00
126_L	193_V	1.557	1.00
9_Y	13_S	1.554	1.00
39_T	192_I	1.551	1.00
196_A	235_A	1.546	1.00
107_R	111_Q	1.530	1.00
21_L	55_P	1.521	1.00
104_D	108_E	1.513	1.00
5_I	234_A	1.510	1.00
48_T	90_P	1.468	1.00
43_M	123_V	1.462	1.00
84_R	95_E	1.461	1.00
45_E	86_L	1.442	1.00
20_L	32_L	1.434	1.00
61_Y	97_N	1.405	1.00
35_T	65_F	1.402	1.00
24_M	60_C	1.394	1.00
19_H	228_I	1.391	1.00
80_I	100_K	1.376	1.00
94_K	97_N	1.338	1.00
7_E	11_E	1.336	1.00
193_V	202_L	1.336	1.00
33_A	122_V	1.324	1.00
121_L	190_L	1.323	1.00
108_E	112_K	1.318	1.00
74_E	81_T	1.313	1.00
201_A	214_V	1.311	1.00
58_D	92_G	1.309	1.00
130_G	214_V	1.284	1.00
126_L	205_V	1.261	1.00
168_F	171_V	1.254	1.00
178_M	182_S	1.247	1.00
126_L	216_A	1.247	1.00
15_V	18_H	1.243	1.00
46_Y	50_L	1.232	1.00
31_N	63_Y	1.217	1.00
205_V	216_A	1.213	1.00
33_A	65_F	1.209	1.00
76_E	81_T	1.209	1.00
188_N	226_M	1.208	1.00
205_V	227_V	1.206	1.00
64_N	83_L	1.202	1.00
16_A	43_M	1.185	1.00
24_M	30_V	1.183	1.00
42_G	45_E	1.177	1.00
43_M	192_I	1.173	1.00
108_E	111_Q	1.171	1.00
133_C	183_I	1.167	1.00
20_L	121_L	1.166	1.00
111_Q	114_A	1.162	1.00
78_V	81_T	1.158	1.00
114_A	185_A	1.154	1.00
19_H	188_N	1.154	1.00
6_T	228_I	1.152	1.00
10_Q	42_G	1.151	1.00
31_N	61_Y	1.133	1.00
221_L	225_L	1.127	1.00
9_Y	42_G	1.122	1.00
199_A	235_A	1.116	1.00
112_K	115_R	1.115	1.00
16_A	190_L	1.111	1.00
93_I	97_N	1.101	1.00
6_T	11_E	1.096	1.00
110_D	182_S	1.085	1.00
16_A	228_I	1.081	1.00
28_R	59_N	1.081	1.00
6_T	12_M	1.071	1.00
19_H	190_L	1.069	1.00
18_H	22_G	1.066	1.00
57_Y	60_C	1.054	1.00
27_T	120_D	1.052	1.00
199_A	203_K	1.044	1.00
41_K	45_E	1.040	1.00
5_I	231_K	1.014	1.00
13_S	43_M	1.012	1.00
201_A	204_N	1.011	1.00
106_Y	110_D	1.005	1.00
166_G	170_L	1.004	1.00
27_T	187_K	1.000	1.00
82_N	86_L	0.998	1.00
61_Y	94_K	0.993	1.00
41_K	82_N	0.991	1.00
33_A	119_L	0.989	1.00
4_I	226_M	0.987	1.00
30_V	60_C	0.987	1.00
103_I	107_R	0.981	1.00
4_I	15_V	0.979	1.00
110_D	145_Q	0.971	1.00
102_T	105_N	0.969	1.00
63_Y	116_E	0.964	1.00
168_F	173_D	0.963	1.00
181_K	185_A	0.961	1.00
9_Y	194_S	0.958	1.00
45_E	90_P	0.936	1.00
56_W	59_N	0.934	1.00
55_P	60_C	0.933	1.00
34_I	62_F	0.920	1.00
180_P	218_V	0.919	1.00
58_D	94_K	0.912	1.00
50_L	54_K	0.902	1.00
30_V	121_L	0.882	1.00
57_Y	91_A	0.882	1.00
12_M	228_I	0.879	1.00
35_T	122_V	0.879	1.00
186_A	189_L	0.878	1.00
102_T	108_E	0.873	1.00
19_H	23_Y	0.872	1.00
4_I	228_I	0.870	1.00
142_F	218_V	0.865	1.00
34_I	44_Y	0.855	0.99
11_E	14_R	0.855	0.99
126_L	202_L	0.855	0.99
148_E	174_S	0.854	0.99
191_I	216_A	0.852	0.99
202_L	205_V	0.852	0.99
184_M	222_H	0.842	0.99
113_L	119_L	0.841	0.99
39_T	194_S	0.840	0.99
27_T	30_V	0.839	0.99
84_R	100_K	0.830	0.99
84_R	98_I	0.824	0.99
66_D	131_H	0.823	0.99
205_V	214_V	0.823	0.99
104_D	107_R	0.821	0.99
72_G	75_G	0.820	0.99
10_Q	46_Y	0.820	0.99
42_G	46_Y	0.815	0.99
119_L	122_V	0.812	0.99
88_F	98_I	0.812	0.99
142_F	212_E	0.807	0.99
214_V	217_S	0.805	0.99
68_I	79_T	0.802	0.99
118_G	187_K	0.800	0.99
20_L	123_V	0.799	0.99
204_N	213_D	0.798	0.99
73_K	84_R	0.796	0.99
202_L	227_V	0.796	0.99
145_Q	181_K	0.794	0.99
189_L	225_L	0.794	0.99
63_Y	112_K	0.792	0.99
68_I	175_Y	0.787	0.99
169_S	173_D	0.783	0.99
10_Q	14_R	0.780	0.99
77_G	173_D	0.769	0.99
40_P	44_Y	0.766	0.99
105_N	176_V	0.764	0.99
35_T	132_F	0.759	0.99
65_F	178_M	0.754	0.99
14_R	18_H	0.754	0.99
184_M	219_L	0.753	0.99
209_P	217_S	0.750	0.99
16_A	192_I	0.748	0.99
65_F	183_I	0.747	0.99
148_E	176_V	0.745	0.99
123_V	192_I	0.743	0.99
63_Y	99_Q	0.742	0.98
83_L	88_F	0.741	0.98
199_A	234_A	0.741	0.98
110_D	147_V	0.739	0.98
229_A	233_A	0.739	0.98
139_T	147_V	0.736	0.98
113_L	118_G	0.733	0.98
45_E	49_T	0.731	0.98
61_Y	116_E	0.730	0.98
183_I	189_L	0.729	0.98
79_T	175_Y	0.728	0.98
69_P	148_E	0.725	0.98
210_V	221_L	0.724	0.98
18_H	54_K	0.724	0.98
38_S	82_N	0.722	0.98
204_N	208_G	0.719	0.98
15_V	19_H	0.712	0.98
32_L	62_F	0.712	0.98
144_E	147_V	0.711	0.98
110_D	114_A	0.707	0.98
128_A	201_A	0.704	0.98
36_A	79_T	0.702	0.98
132_F	191_I	0.701	0.98
10_Q	45_E	0.700	0.98
9_Y	12_M	0.700	0.98
168_F	172_P	0.700	0.98
11_E	15_V	0.697	0.98
73_K	100_K	0.697	0.98
124_L	183_I	0.696	0.98
138_N	212_E	0.695	0.98
68_I	134_G	0.695	0.98
130_G	201_A	0.695	0.98
184_M	221_L	0.692	0.98
200_Q	203_K	0.692	0.98
16_A	20_L	0.681	0.97
133_C	177_T	0.677	0.97
126_L	201_A	0.671	0.97
29_R	59_N	0.662	0.97
21_L	47_L	0.652	0.97
50_L	55_P	0.652	0.97
48_T	86_L	0.647	0.96
38_S	128_A	0.645	0.96
17_A	47_L	0.644	0.96
47_L	57_Y	0.643	0.96
15_V	228_I	0.640	0.96
94_K	98_I	0.640	0.96
62_F	83_L	0.639	0.96
230_D	233_A	0.639	0.96
20_L	24_M	0.638	0.96
5_I	229_A	0.633	0.96
140_T	143_H	0.629	0.96
95_E	98_I	0.627	0.96
38_S	41_K	0.622	0.96
21_L	54_K	0.622	0.96
53_G	57_Y	0.618	0.95
68_I	136_L	0.612	0.95
17_A	46_Y	0.606	0.95
63_Y	113_L	0.604	0.95
180_P	215_P	0.604	0.95
34_I	83_L	0.604	0.95
77_G	170_L	0.603	0.95
14_R	50_L	0.600	0.95
64_N	100_K	0.600	0.95
27_T	59_N	0.600	0.95
139_T	213_D	0.597	0.94
122_V	183_I	0.593	0.94
206_L	227_V	0.592	0.94
190_L	228_I	0.588	0.94
70_F	78_V	0.588	0.94
24_M	32_L	0.587	0.94
13_S	46_Y	0.586	0.94
201_A	205_V	0.583	0.94
134_G	175_Y	0.582	0.94
63_Y	119_L	0.581	0.94
64_N	80_I	0.577	0.93
136_L	175_Y	0.577	0.93
96_E	101_L	0.576	0.93
50_L	53_G	0.575	0.93
65_F	133_C	0.573	0.93
218_V	221_L	0.570	0.93
19_H	226_M	0.569	0.93
22_G	25_S	0.568	0.93
65_F	122_V	0.565	0.93
208_G	211_T	0.564	0.93
232_A	235_A	0.562	0.93
189_L	219_L	0.559	0.92
205_V	220_Q	0.558	0.92
106_Y	109_H	0.556	0.92
148_E	152_Q	0.555	0.92
191_I	227_V	0.554	0.92
202_L	206_L	0.553	0.92
144_E	181_K	0.552	0.92
93_I	96_E	0.552	0.92
35_T	44_Y	0.551	0.92
167_D	173_D	0.551	0.92
80_I	98_I	0.548	0.92
97_N	101_L	0.547	0.92
17_A	21_L	0.545	0.91
139_T	144_E	0.545	0.91
187_K	223_P	0.544	0.91
211_T	217_S	0.543	0.91
169_S	172_P	0.541	0.91
209_P	220_Q	0.538	0.91
66_D	198_K	0.536	0.91
208_G	220_Q	0.536	0.91
125_G	198_K	0.536	0.91
3_L	206_L	0.533	0.90
122_V	133_C	0.530	0.90
101_L	109_H	0.530	0.90
54_K	91_A	0.529	0.90
84_R	88_F	0.529	0.90
79_T	136_L	0.526	0.90
170_L	173_D	0.526	0.90
119_L	186_A	0.526	0.90
177_T	181_K	0.525	0.90
31_N	117_G	0.525	0.90
167_D	172_P	0.523	0.90
87_F	91_A	0.522	0.90
79_T	134_G	0.521	0.89
19_H	22_G	0.521	0.89
149_F	175_Y	0.516	0.89
36_A	136_L	0.515	0.89
135_N	183_I	0.509	0.88
208_G	214_V	0.509	0.88
21_L	25_S	0.508	0.88
113_L	117_G	0.507	0.88
12_M	16_A	0.504	0.88
132_F	219_L	0.501	0.88
49_T	90_P	0.500	0.87
16_A	24_M	0.500	0.87

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3tx2A	1	0.9292	100	0.097	Contact Map
3icoA	1	0.9333	100	0.1	Contact Map
4tm7A	1	0.925	100	0.101	Contact Map
3eb9A	1	0.925	100	0.11	Contact Map
3cssA	1	0.9292	100	0.164	Contact Map
3e15A	2	0.9792	100	0.164	Contact Map
1vl1A	1	0.8625	100	0.171	Contact Map
3lwdA	2	0.8833	100	0.195	Contact Map
1y89A	2	0.925	100	0.209	Contact Map
3lhiA	1	0.8958	100	0.211	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0087 seconds.