GLVG - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GLVG - Putative inactive 6-phospho-alpha-glucosidase

UniProt:	P31450	Sequences: MTKFSVVVAGGGSTFTPGIVLMLLANQDRFPLRALKFYDNDGARQEVIAEACKVILKEKAPDIAFSYTTDPEVAFSDVDFVMAHIRVGKYPMRELDEKIPLRHGVVGQETCGPGGIAYGMRSIGGVLELVDYMEKYSPNAWMLNYSNPAAIVAEATRRLRPNAKILNICDMPIGIESRMAQIVGLQDRKQMRVRYYGLNHWWSAISRSFRKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11708
Length:	212 (202)
Sequences:	1615 (832)
Seq/√Len:	58.5

ECOLI - GLVG AGAL CHBF
BACSU - GLVA LICH AGAL LPLD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
72_E	135_K	5.166	1.00
71_P	132_Y	4.303	1.00
75_F	137_S	3.729	1.00
133_M	142_M	3.619	1.00
49_A	67_Y	3.456	1.00
72_E	132_Y	3.158	1.00
134_E	160_R	3.080	1.00
49_A	53_K	3.070	1.00
34_A	66_S	3.025	1.00
133_M	163_A	2.933	1.00
34_A	64_A	2.807	1.00
5_S	36_K	2.754	1.00
70_D	73_V	2.555	1.00
36_K	66_S	2.376	1.00
123_I	155_A	2.291	1.00
141_W	164_K	2.289	1.00
130_V	156_T	2.258	1.00
105_V	113_P	2.254	1.00
187_D	190_Q	2.252	1.00
87_V	125_G	2.224	1.00
133_M	137_S	2.182	1.00
73_V	76_S	2.141	1.00
46_E	49_A	2.106	1.00
131_D	134_E	2.086	1.00
66_S	73_V	2.050	1.00
134_E	162_N	2.000	1.00
46_E	50_E	1.981	1.00
72_E	136_Y	1.957	1.00
128_E	131_D	1.950	1.00
127_L	155_A	1.885	1.00
194_R	206_S	1.861	1.00
36_K	68_T	1.760	0.99
123_I	151_I	1.734	0.99
7_V	78_V	1.731	0.99
12_G	39_D	1.648	0.99
5_S	34_A	1.644	0.99
196_Y	205_I	1.644	0.99
56_L	65_F	1.622	0.99
122_S	125_G	1.605	0.99
83_A	126_V	1.566	0.98
42_G	46_E	1.558	0.98
139_N	164_K	1.526	0.98
68_T	74_A	1.511	0.98
91_P	94_E	1.505	0.98
94_E	98_K	1.500	0.98
86_R	93_R	1.445	0.97
50_E	53_K	1.392	0.97
56_L	63_I	1.381	0.97
97_E	107_G	1.373	0.96
7_V	75_F	1.366	0.96
81_V	133_M	1.341	0.96
93_R	107_G	1.340	0.96
156_T	165_I	1.338	0.96
85_I	129_L	1.323	0.96
130_V	133_M	1.322	0.96
53_K	57_K	1.320	0.95
126_V	156_T	1.315	0.95
154_E	158_R	1.314	0.95
20_V	35_L	1.314	0.95
100_P	103_H	1.296	0.95
126_V	152_V	1.288	0.95
119_G	123_I	1.272	0.94
96_D	121_R	1.259	0.94
79_D	139_N	1.246	0.94
195_Y	204_A	1.236	0.94
192_R	208_S	1.233	0.94
92_M	95_L	1.206	0.93
16_T	84_H	1.201	0.93
7_V	36_K	1.200	0.93
6_V	30_F	1.182	0.92
132_Y	136_Y	1.167	0.91
22_M	170_D	1.164	0.91
38_Y	74_A	1.162	0.91
93_R	97_E	1.161	0.91
81_V	140_A	1.126	0.90
176_E	193_V	1.126	0.90
160_R	163_A	1.121	0.90
41_D	89_K	1.114	0.89
111_C	201_W	1.110	0.89
115_G	121_R	1.088	0.88
76_S	136_Y	1.085	0.88
42_G	69_T	1.079	0.88
46_E	67_Y	1.071	0.88
131_D	160_R	1.055	0.87
195_Y	202_W	1.049	0.86
9_A	129_L	1.044	0.86
19_I	84_H	1.041	0.86
100_P	117_A	1.003	0.84
52_C	65_F	0.999	0.84
7_V	38_Y	0.996	0.83
125_G	128_E	0.991	0.83
17_P	109_E	0.989	0.83
75_F	136_Y	0.982	0.83
71_P	75_F	0.976	0.82
150_A	201_W	0.964	0.81
85_I	149_A	0.958	0.81
9_A	142_M	0.949	0.80
45_Q	67_Y	0.949	0.80
169_C	200_H	0.946	0.80
175_I	202_W	0.941	0.80
145_Y	150_A	0.938	0.80
131_D	159_L	0.936	0.79
149_A	172_P	0.935	0.79
177_S	188_R	0.932	0.79
96_D	115_G	0.932	0.79
127_L	159_L	0.932	0.79
176_E	204_A	0.931	0.79
110_T	115_G	0.929	0.79
86_R	97_E	0.929	0.79
184_G	187_D	0.924	0.79
119_G	155_A	0.912	0.78
130_V	162_N	0.907	0.77
152_V	155_A	0.898	0.77
131_D	135_K	0.898	0.77
33_R	64_A	0.897	0.76
24_L	56_L	0.893	0.76
6_V	23_L	0.893	0.76
109_E	118_Y	0.890	0.76
23_L	35_L	0.884	0.75
174_G	178_R	0.879	0.75
100_P	114_G	0.873	0.74
91_P	95_L	0.871	0.74
77_D	139_N	0.866	0.74
95_L	99_I	0.862	0.74
15_F	84_H	0.860	0.73
194_R	205_I	0.858	0.73
111_C	151_I	0.855	0.73
35_L	63_I	0.852	0.73
153_A	167_N	0.851	0.73
43_A	46_E	0.850	0.72
56_L	61_P	0.840	0.72
109_E	198_L	0.838	0.71
86_R	118_Y	0.836	0.71
37_F	52_C	0.834	0.71
97_E	108_Q	0.829	0.71
185_L	190_Q	0.824	0.70
13_S	18_G	0.812	0.69
193_V	204_A	0.808	0.69
179_M	207_R	0.808	0.69
128_E	132_Y	0.803	0.68
9_A	75_F	0.802	0.68
53_K	183_V	0.801	0.68
110_T	151_I	0.797	0.68
171_M	202_W	0.792	0.67
127_L	131_D	0.792	0.67
117_A	137_S	0.790	0.67
113_P	157_R	0.789	0.67
157_R	165_I	0.786	0.66
53_K	73_V	0.784	0.66
142_M	163_A	0.783	0.66
192_R	206_S	0.782	0.66
171_M	175_I	0.773	0.65
180_A	203_S	0.771	0.65
8_V	82_M	0.760	0.64
5_S	78_V	0.760	0.64
48_I	52_C	0.752	0.63
52_C	56_L	0.746	0.62
78_V	137_S	0.741	0.62
71_P	128_E	0.740	0.62
65_F	173_I	0.736	0.61
110_T	121_R	0.731	0.61
57_K	191_M	0.727	0.60
107_G	114_G	0.727	0.60
176_E	188_R	0.720	0.60
55_I	59_K	0.715	0.59
45_Q	69_T	0.713	0.59
66_S	135_K	0.712	0.59
134_E	163_A	0.709	0.58
55_I	140_A	0.708	0.58
97_E	109_E	0.706	0.58
53_K	139_N	0.703	0.58
82_M	164_K	0.697	0.57
106_V	109_E	0.691	0.57
75_F	132_Y	0.690	0.56
86_R	107_G	0.687	0.56
14_T	90_Y	0.677	0.55
12_G	40_N	0.674	0.55
169_C	199_N	0.668	0.54
38_Y	75_F	0.667	0.54
16_T	19_I	0.666	0.54
68_T	73_V	0.665	0.54
183_V	207_R	0.664	0.54
18_G	145_Y	0.662	0.53
119_G	151_I	0.661	0.53
87_V	122_S	0.661	0.53
75_F	81_V	0.659	0.53
150_A	172_P	0.658	0.53
44_R	93_R	0.656	0.53
122_S	152_V	0.655	0.53
42_G	135_K	0.653	0.52
83_A	146_S	0.652	0.52
78_V	81_V	0.652	0.52
24_L	90_Y	0.650	0.52
18_G	170_D	0.645	0.51
147_N	199_N	0.644	0.51
69_T	73_V	0.643	0.51
149_A	170_D	0.640	0.51
180_A	185_L	0.640	0.51
118_Y	122_S	0.639	0.51
149_A	171_M	0.638	0.51
91_P	131_D	0.636	0.50
97_E	106_V	0.632	0.50
109_E	149_A	0.629	0.50
112_G	121_R	0.627	0.49
17_P	51_A	0.626	0.49
180_A	191_M	0.626	0.49
18_G	21_L	0.621	0.49
143_L	166_L	0.620	0.49
76_S	131_D	0.619	0.49
15_F	90_Y	0.616	0.48
181_Q	189_K	0.615	0.48
53_K	66_S	0.614	0.48
53_K	64_A	0.609	0.47
83_A	165_I	0.605	0.47
109_E	145_Y	0.604	0.47
131_D	162_N	0.603	0.47
4_F	33_R	0.601	0.47
137_S	163_A	0.601	0.47
26_N	29_R	0.597	0.46
94_E	113_P	0.594	0.46
53_K	67_Y	0.593	0.46
18_G	22_M	0.592	0.46
9_A	40_N	0.592	0.46
197_G	200_H	0.591	0.45
28_D	31_P	0.590	0.45
95_L	102_R	0.590	0.45
9_A	71_P	0.590	0.45
4_F	24_L	0.589	0.45
52_C	84_H	0.588	0.45
176_E	191_M	0.586	0.45
108_Q	153_A	0.576	0.44
96_D	112_G	0.572	0.43
17_P	201_W	0.572	0.43
8_V	20_V	0.571	0.43
9_A	38_Y	0.571	0.43
99_I	103_H	0.568	0.43
116_I	119_G	0.564	0.43
56_L	62_D	0.563	0.42
51_A	58_E	0.563	0.42
6_V	104_G	0.563	0.42
93_R	109_E	0.562	0.42
111_C	117_A	0.562	0.42
48_I	67_Y	0.562	0.42
39_D	108_Q	0.561	0.42
160_R	201_W	0.559	0.42
141_W	195_Y	0.556	0.42
131_D	163_A	0.553	0.41
103_H	113_P	0.553	0.41
88_G	92_M	0.553	0.41
153_A	165_I	0.553	0.41
113_P	166_L	0.550	0.41
80_F	143_L	0.548	0.41
93_R	106_V	0.547	0.41
147_N	200_H	0.546	0.41
141_W	166_L	0.543	0.40
20_V	56_L	0.542	0.40
93_R	108_Q	0.542	0.40
87_V	114_G	0.542	0.40
96_D	114_G	0.542	0.40
100_P	113_P	0.541	0.40
147_N	169_C	0.540	0.40
109_E	172_P	0.538	0.40
86_R	101_L	0.537	0.40
50_E	67_Y	0.533	0.39
11_G	168_I	0.533	0.39
128_E	135_K	0.532	0.39
110_T	118_Y	0.530	0.39
112_G	146_S	0.525	0.38
14_T	18_G	0.524	0.38
8_V	89_K	0.524	0.38
123_I	144_N	0.523	0.38
89_K	146_S	0.523	0.38
174_G	177_S	0.522	0.38
98_K	102_R	0.522	0.38
93_R	110_T	0.520	0.38
11_G	52_C	0.520	0.38
11_G	49_A	0.519	0.38
97_E	172_P	0.518	0.38
83_A	133_M	0.517	0.38
46_E	128_E	0.517	0.38
117_A	205_I	0.516	0.37
142_M	156_T	0.516	0.37
20_V	52_C	0.516	0.37
85_I	125_G	0.514	0.37
121_R	145_Y	0.513	0.37
23_L	52_C	0.513	0.37
92_M	125_G	0.513	0.37
29_R	181_Q	0.513	0.37
88_G	115_G	0.513	0.37
49_A	65_F	0.511	0.37
114_G	121_R	0.511	0.37
188_R	191_M	0.510	0.37
184_G	192_R	0.509	0.37
7_V	81_V	0.509	0.37
191_M	207_R	0.508	0.37
175_I	207_R	0.508	0.37
51_A	116_I	0.508	0.37
10_G	13_S	0.507	0.37
191_M	204_A	0.504	0.36
17_P	97_E	0.504	0.36
17_P	107_G	0.503	0.36
24_L	116_I	0.502	0.36
178_R	182_I	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1u8xX	1	0.9858	100	0.387	Contact Map
1obbA	2	0.967	100	0.398	Contact Map
1up7A	3	0.967	100	0.4	Contact Map
1s6yA	1	0.9811	100	0.401	Contact Map
3u95A	2	0.9623	100	0.44	Contact Map
3fefA	3	0.967	100	0.454	Contact Map
1pzgA	4	0.8962	100	0.631	Contact Map
4plzA	4	0.8208	100	0.648	Contact Map
4rorA	4	0.8585	100	0.656	Contact Map
2hjrA	4	0.8491	100	0.658	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0083 seconds.