HPPK - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HPPK - 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

UniProt:	P26281	Sequences: MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11374
Length:	159 (148)
Sequences:	4529 (3462)
Seq/√Len:	284.6

ECOLI - HPPK
BACSU - HPPK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_S	131_E	3.715	1.00
118_D	121_N	2.936	1.00
38_S	57_A	2.807	1.00
81_Q	95_L	2.451	1.00
72_N	111_R	2.410	1.00
6_I	97_L	2.408	1.00
142_E	150_T	2.343	1.00
68_E	109_T	2.269	1.00
25_A	80_Q	2.233	1.00
3_V	60_A	2.215	1.00
74_T	97_L	2.109	1.00
44_P	53_D	2.095	1.00
29_I	73_H	2.003	1.00
100_M	119_M	1.997	1.00
42_R	53_D	1.980	1.00
23_L	59_V	1.974	1.00
41_Y	131_E	1.910	1.00
15_P	42_R	1.904	1.00
68_E	111_R	1.888	1.00
46_L	118_D	1.822	1.00
10_S	15_P	1.791	1.00
3_V	62_E	1.748	1.00
75_Q	85_R	1.748	1.00
5_Y	60_A	1.745	1.00
107_I	114_V	1.728	1.00
108_N	113_T	1.727	1.00
66_A	69_E	1.623	1.00
10_S	18_Q	1.614	1.00
23_L	37_V	1.578	1.00
123_G	127_W	1.577	1.00
14_S	17_E	1.571	1.00
8_I	19_V	1.560	1.00
29_I	32_S	1.505	1.00
15_P	18_Q	1.504	1.00
40_F	55_L	1.493	1.00
48_P	88_E	1.487	1.00
101_L	136_L	1.486	1.00
4_A	61_L	1.460	1.00
36_T	60_A	1.448	1.00
76_R	80_Q	1.391	1.00
25_A	81_Q	1.379	1.00
73_H	76_R	1.376	1.00
143_M	146_Q	1.373	1.00
40_F	57_A	1.354	1.00
17_E	21_A	1.343	1.00
51_Q	92_P	1.337	1.00
48_P	54_Y	1.330	1.00
47_G	90_W	1.325	1.00
120_K	147_I	1.296	1.00
35_L	60_A	1.290	1.00
16_L	20_N	1.273	1.00
20_N	40_F	1.250	1.00
35_L	62_E	1.231	1.00
21_A	81_Q	1.204	1.00
18_Q	81_Q	1.199	1.00
63_T	102_F	1.171	1.00
5_Y	133_A	1.160	1.00
7_A	100_M	1.156	1.00
101_L	104_N	1.155	1.00
33_H	62_E	1.127	1.00
36_T	132_I	1.126	1.00
6_I	74_T	1.107	1.00
4_A	70_L	1.078	1.00
12_L	52_P	1.073	1.00
101_L	119_M	1.070	1.00
85_R	94_T	1.051	1.00
127_W	148_L	1.043	1.00
15_P	55_L	1.040	1.00
27_G	34_I	1.031	1.00
21_A	25_A	1.023	1.00
32_S	61_L	1.020	1.00
6_I	61_L	1.013	1.00
7_A	57_A	1.002	1.00
99_I	114_V	1.001	1.00
130_F	148_L	1.001	1.00
26_L	59_V	0.999	1.00
88_E	91_G	0.997	1.00
34_I	61_L	0.995	1.00
4_A	102_F	0.988	1.00
5_Y	101_L	0.978	1.00
48_P	90_W	0.976	1.00
130_F	144_L	0.961	1.00
51_Q	91_G	0.956	1.00
7_A	125_M	0.956	1.00
89_R	118_D	0.956	1.00
19_V	40_F	0.955	1.00
81_Q	94_T	0.949	1.00
5_Y	129_L	0.937	1.00
37_V	59_V	0.935	1.00
145_R	149_H	0.924	1.00
8_I	57_A	0.924	1.00
133_A	136_L	0.915	1.00
41_Y	127_W	0.912	1.00
32_S	73_H	0.906	1.00
5_Y	136_L	0.906	1.00
142_E	146_Q	0.906	1.00
4_A	63_T	0.902	1.00
8_I	59_V	0.900	1.00
101_L	144_L	0.899	1.00
119_M	125_M	0.895	1.00
25_A	28_D	0.883	1.00
148_L	151_R	0.872	1.00
21_A	24_K	0.857	1.00
120_K	138_F	0.850	1.00
19_V	57_A	0.841	1.00
13_A	18_Q	0.834	1.00
130_F	145_R	0.831	1.00
101_L	114_V	0.825	1.00
125_M	128_P	0.824	1.00
25_A	77_I	0.822	1.00
15_P	52_P	0.813	0.99
37_V	57_A	0.809	0.99
71_L	75_Q	0.809	0.99
68_E	107_I	0.807	0.99
105_E	114_V	0.802	0.99
106_V	139_P	0.802	0.99
126_L	148_L	0.793	0.99
60_A	133_A	0.792	0.99
19_V	55_L	0.788	0.99
135_E	145_R	0.786	0.99
16_L	55_L	0.783	0.99
68_E	72_N	0.783	0.99
88_E	92_P	0.779	0.99
67_P	105_E	0.775	0.99
65_L	73_H	0.775	0.99
86_K	91_G	0.772	0.99
75_Q	79_L	0.770	0.99
60_A	132_I	0.762	0.99
10_S	19_V	0.760	0.99
31_E	64_S	0.760	0.99
146_Q	149_H	0.758	0.99
26_L	74_T	0.758	0.99
70_L	102_F	0.755	0.99
29_I	76_R	0.750	0.99
58_A	129_L	0.743	0.99
50_D	92_P	0.742	0.99
49_Q	54_Y	0.728	0.99
136_L	144_L	0.727	0.99
129_L	144_L	0.727	0.99
16_L	40_F	0.712	0.99
45_P	53_D	0.712	0.99
50_D	54_Y	0.709	0.99
20_N	24_K	0.709	0.99
15_P	53_D	0.704	0.99
18_Q	94_T	0.695	0.98
52_P	92_P	0.691	0.98
5_Y	100_M	0.689	0.98
24_K	28_D	0.687	0.98
137_V	143_M	0.686	0.98
138_F	147_I	0.684	0.98
29_I	65_L	0.683	0.98
71_L	112_L	0.680	0.98
63_T	70_L	0.678	0.98
84_V	88_E	0.667	0.98
58_A	100_M	0.663	0.98
138_F	144_L	0.662	0.98
32_S	70_L	0.661	0.98
79_L	85_R	0.644	0.97
41_Y	128_P	0.643	0.97
65_L	69_E	0.643	0.97
90_W	118_D	0.640	0.97
48_P	51_Q	0.626	0.97
8_I	22_A	0.624	0.97
58_A	125_M	0.622	0.97
25_A	29_I	0.621	0.97
5_Y	58_A	0.616	0.97
22_A	77_I	0.615	0.97
23_L	34_I	0.613	0.97
61_L	70_L	0.612	0.96
142_E	147_I	0.609	0.96
42_R	55_L	0.608	0.96
127_W	131_E	0.606	0.96
82_G	94_T	0.604	0.96
113_T	117_Y	0.604	0.96
45_P	51_Q	0.602	0.96
77_I	81_Q	0.599	0.96
20_N	37_V	0.593	0.96
116_H	122_R	0.592	0.96
100_M	125_M	0.592	0.96
137_V	141_G	0.591	0.96
44_P	123_G	0.587	0.96
43_T	127_W	0.581	0.95
3_V	35_L	0.580	0.95
47_G	51_Q	0.578	0.95
107_I	112_L	0.574	0.95
46_L	90_W	0.574	0.95
75_Q	111_R	0.570	0.95
123_G	148_L	0.570	0.95
46_L	123_G	0.570	0.95
6_I	99_I	0.570	0.95
26_L	61_L	0.570	0.95
69_E	72_N	0.569	0.95
46_L	121_N	0.568	0.95
74_T	99_I	0.564	0.95
73_H	77_I	0.562	0.94
19_V	23_L	0.556	0.94
138_F	141_G	0.556	0.94
119_M	126_L	0.556	0.94
146_Q	150_T	0.553	0.94
134_P	145_R	0.551	0.94
29_I	80_Q	0.551	0.94
126_L	147_I	0.551	0.94
26_L	29_I	0.550	0.94
47_G	54_Y	0.549	0.94
123_G	151_R	0.546	0.94
26_L	32_S	0.544	0.93
76_R	79_L	0.531	0.93
77_I	97_L	0.529	0.92
135_E	143_M	0.526	0.92
34_I	37_V	0.522	0.92
22_A	95_L	0.521	0.92
34_I	59_V	0.520	0.92
138_F	142_E	0.517	0.92
86_K	90_W	0.515	0.91
101_L	129_L	0.514	0.91
126_L	144_L	0.513	0.91
119_M	129_L	0.506	0.91
137_V	142_E	0.503	0.90
102_F	114_V	0.503	0.90
111_R	114_V	0.501	0.90
106_V	138_F	0.501	0.90
101_L	139_P	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qx0A	2	1	100	0.037	Contact Map
1cbkA	2	0.9937	100	0.037	Contact Map
3ip0A	2	0.9937	100	0.052	Contact Map
4cwbA	1	0.9811	100	0.061	Contact Map
2cg8A	4	0.8428	100	0.073	Contact Map
2bmbA	1	0.9371	100	0.085	Contact Map
4pzvA	1	0.9811	100	0.129	Contact Map
3r4vA	1	0.6541	31.6	0.941	Contact Map
2rffA	1	0.6667	23.8	0.944	Contact Map
4lhsA	2	0.7421	21.3	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.