PSPE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PSPE - Thiosulfate sulfurtransferase PspE

UniProt:	P23857	Sequences: MFKKGLLALALVFSLPVFAAEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKNDTVKVYCNAGRQSGQAKEILSEMGYTHVENAGGLKDIAMPKVKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10780
Length:	104 (94)
Sequences:	10081 (7268)
Seq/√Len:	749.6

ECOLI - PSPE YIBN THTM YGAP GLPE YNJE SELU
BACSU - YTWF YQHL YRKF YRKH
HALSA - Q9HMT6 Q9HME4 Q9HMT7 Q9HS22 O54661 O54647
SULSO - Q97ZB1 Q97VI9 Q97XC6 Q7LX53

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_T	89_E	3.044	1.00
7_L	11_L	2.324	1.00
22_H	61_D	2.306	1.00
96_D	100_P	2.258	1.00
35_E	98_A	2.192	1.00
8_A	11_L	2.087	1.00
11_L	15_L	2.078	1.00
32_Y	36_H	2.043	1.00
29_P	33_Q	2.025	1.00
9_L	96_D	1.788	1.00
9_L	100_P	1.769	1.00
65_V	80_L	1.758	1.00
49_K	53_A	1.713	1.00
48_V	52_I	1.652	1.00
62_T	87_H	1.628	1.00
12_V	23_W	1.554	1.00
77_K	88_V	1.496	1.00
31_Q	72_Q	1.483	1.00
29_P	42_N	1.477	1.00
26_V	76_A	1.465	1.00
15_L	18_F	1.454	1.00
9_L	13_F	1.400	1.00
51_R	54_T	1.397	1.00
92_G	96_D	1.387	1.00
21_E	64_K	1.324	1.00
73_S	90_N	1.317	1.00
43_I	55_A	1.290	1.00
94_L	98_A	1.279	1.00
58_D	61_D	1.270	1.00
77_K	90_N	1.251	1.00
43_I	51_R	1.231	1.00
36_H	66_Y	1.220	1.00
47_E	51_R	1.217	1.00
51_R	55_A	1.199	1.00
31_Q	68_N	1.192	1.00
15_L	21_E	1.179	1.00
8_A	91_A	1.155	1.00
15_L	62_T	1.152	1.00
38_Q	97_I	1.147	1.00
66_Y	94_L	1.137	1.00
37_V	66_Y	1.131	1.00
7_L	12_V	1.120	1.00
22_H	41_I	1.119	1.00
65_V	76_A	1.115	1.00
77_K	81_S	1.098	1.00
47_E	50_E	1.096	1.00
80_L	88_V	1.090	1.00
27_R	68_N	1.076	1.00
50_E	54_T	1.065	1.00
59_K	85_Y	1.053	1.00
37_V	40_A	1.048	1.00
23_W	37_V	1.047	1.00
65_V	88_V	1.044	1.00
81_S	86_T	1.039	1.00
63_V	80_L	1.026	1.00
23_W	66_Y	1.011	1.00
27_R	94_L	1.006	1.00
65_V	77_K	1.006	1.00
26_V	65_V	0.995	1.00
24_I	57_P	0.990	1.00
28_V	31_Q	0.990	1.00
28_V	42_N	0.977	1.00
69_A	95_K	0.951	1.00
10_A	14_S	0.947	1.00
67_C	70_G	0.928	1.00
12_V	15_L	0.928	1.00
95_K	99_M	0.924	1.00
52_I	80_L	0.918	1.00
95_K	98_A	0.913	1.00
40_A	66_Y	0.908	1.00
67_C	73_S	0.894	1.00
81_S	88_V	0.892	1.00
79_I	83_M	0.888	1.00
96_D	99_M	0.882	1.00
12_V	64_K	0.879	1.00
22_H	63_V	0.872	1.00
7_L	89_E	0.861	1.00
31_Q	34_Q	0.848	1.00
48_V	83_M	0.848	1.00
35_E	94_L	0.828	1.00
74_G	90_N	0.807	1.00
30_E	33_Q	0.801	1.00
36_H	42_N	0.796	1.00
69_A	72_Q	0.784	1.00
21_E	62_T	0.780	1.00
28_V	72_Q	0.770	1.00
63_V	85_Y	0.766	1.00
68_N	95_K	0.755	1.00
78_E	82_E	0.746	1.00
45_L	75_Q	0.742	1.00
13_F	16_P	0.738	1.00
24_I	41_I	0.731	1.00
37_V	97_I	0.729	1.00
32_Y	42_N	0.726	1.00
46_K	49_K	0.722	1.00
11_L	14_S	0.712	1.00
32_Y	40_A	0.694	1.00
48_V	79_I	0.684	1.00
80_L	85_Y	0.681	1.00
68_N	71_R	0.680	1.00
79_I	82_E	0.672	1.00
12_V	21_E	0.672	1.00
31_Q	69_A	0.664	1.00
43_I	76_A	0.662	1.00
24_I	76_A	0.657	1.00
10_A	100_P	0.656	1.00
26_V	45_L	0.655	1.00
81_S	87_H	0.645	1.00
29_P	44_P	0.645	1.00
67_C	72_Q	0.641	1.00
20_A	62_T	0.640	1.00
93_G	96_D	0.633	1.00
52_I	56_V	0.600	1.00
12_V	16_P	0.592	1.00
75_Q	82_E	0.586	1.00
27_R	35_E	0.582	1.00
22_H	57_P	0.580	1.00
17_V	20_A	0.579	1.00
7_L	15_L	0.574	1.00
57_P	63_V	0.572	1.00
36_H	40_A	0.569	1.00
82_E	85_Y	0.567	1.00
67_C	93_G	0.563	1.00
30_E	34_Q	0.558	1.00
56_V	85_Y	0.540	1.00
60_N	87_H	0.539	1.00
85_Y	88_V	0.534	1.00
78_E	81_S	0.531	1.00
22_H	62_T	0.529	1.00
74_G	78_E	0.521	1.00
46_K	50_E	0.519	1.00
7_L	21_E	0.517	1.00
28_V	44_P	0.517	1.00
41_I	55_A	0.516	1.00
24_I	80_L	0.514	1.00
27_R	42_N	0.513	1.00
7_L	64_K	0.506	1.00
32_Y	66_Y	0.505	1.00
53_A	59_K	0.504	1.00
53_A	58_D	0.504	1.00
42_N	45_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2k0zA	1	0.9615	99.9	0.206	Contact Map
3hzuA	2	1	99.9	0.225	Contact Map
1yt8A	1	0.9712	99.9	0.229	Contact Map
3aayA	1	1	99.9	0.23	Contact Map
1e0cA	1	1	99.9	0.23	Contact Map
1uarA	1	1	99.9	0.23	Contact Map
1urhA	1	0.9808	99.9	0.232	Contact Map
3tp9A	2	0.9808	99.8	0.244	Contact Map
1rhsA	1	1	99.8	0.248	Contact Map
2wlrA	1	1	99.8	0.249	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.